DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Pdgfrl

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001011921.1 Gene:Pdgfrl / 290771 RGDID:1308028 Length:375 Species:Rattus norvegicus


Alignment Length:465 Identity:81/465 - (17%)
Similarity:127/465 - (27%) Gaps:201/465 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 QPAVQVEGRRQMANSQ-----EMIKDHLGARSQNKTPAITNNANQSSTSSADLDDGAADDDDNKA 91
            :|..|.|.|.:..|.:     ..|||...|.|..|:.:|...|         :|:|.........
  Rat    29 RPKEQGENRIKPTNKKAKPKIPKIKDRDTADSAPKSQSIMMQA---------MDNGRFQKPAATV 84

  Fly    92 DLPVNVS-------SKPYWRNPKKMSFLQTRPSGSLLTLNCHALGNPEPNITWYRNGTVDWTRGY 149
            .|....|       ||..|..|   ::|.|.....|                     ||.....|
  Rat    85 SLMAGQSVELRCKGSKVEWSYP---AYLDTFKDSRL---------------------TVKQNERY 125

  Fly   150 GSLKRNRWTLTMEDLVPGDCGNYTC--KVCNSLGCIRHDTQVIVSDRVNHKPILMTGPLNLTLVV 212
            |.       ||:.:....|.|.::|  ::||...|.|.:.:                        
  Rat   126 GQ-------LTLVNSTTADTGEFSCWERLCNGYICRRDEAR------------------------ 159

  Fly   213 NSTGSMHCKYLSDLTSKKAWIFVPCHGMTNCSNNRSIIAEDKDQLDFVNVRMEQEGWYTCVESNS 277
              |||.:..:     ::|..:|||                .....|.|.:..:::....|     
  Rat   160 --TGSTYIFF-----TEKGELFVP----------------SPSYFDVVYLNPDRQAVVPC----- 196

  Fly   278 LGQSNSTAYLRVVRSLHVLEAGVASGSLH-----------STSFVYIFVFGGLIFIFMTTLFVFY 331
                      ||.       |..|..:||           .|..||....|   |:::..     
  Rat   197 ----------RVT-------APSAKVTLHREFPAKEIPANGTDIVYDMKRG---FVYLQP----- 236

  Fly   332 AIRKMKHEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSMDTMIMPV-VRIQKQRTTVLQNGNE- 394
                              |...:.|:..|.|.||.|..|:...::.| |......||:|.:.|: 
  Rat   237 ------------------HSDHQGVVYCKAEAGGKSQISVKYQLLYVEVPSGPPSTTILASSNKV 283

  Fly   395 --------------------------PAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMA 433
                                      |...:|....:...|.|  .|..||.|           .
  Rat   284 RGGDDISVLCTVLGEPDVEVEFRWIFPGQKDERPVTIQDTWRL--IHRGLGHT-----------T 335

  Fly   434 EVNNAIVAVK 443
            .::.:::.|:
  Rat   336 RISQSVITVE 345

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 18/91 (20%)
Ig strand B 121..125 CDD:409353 0/3 (0%)
Ig strand C 134..138 CDD:409353 0/3 (0%)
Ig strand E 157..161 CDD:409353 1/3 (33%)
Ig strand F 171..176 CDD:409353 1/6 (17%)
Ig strand G 184..187 CDD:409353 1/2 (50%)
Ig 200..289 CDD:472250 10/88 (11%)
Ig strand B 216..220 CDD:409353 2/3 (67%)
Ig strand C 229..233 CDD:409353 1/3 (33%)
Ig strand E 255..259 CDD:409353 0/3 (0%)
Ig strand F 269..274 CDD:409353 1/4 (25%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864 7/40 (18%)
PdgfrlNP_001011921.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..63 10/33 (30%)
IG_like 83..>143 CDD:214653 17/90 (19%)
Ig 278..372 CDD:472250 10/81 (12%)
Ig strand B 289..293 CDD:409353 0/3 (0%)
Ig strand C 304..308 CDD:409353 0/3 (0%)
Ig strand E 340..344 CDD:409353 0/3 (0%)
Ig strand F 354..359 CDD:409353
Ig strand G 367..370 CDD:409353
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.