DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and FLT1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_002010.2 Gene:FLT1 / 2321 HGNCID:3763 Length:1338 Species:Homo sapiens


Alignment Length:773 Identity:222/773 - (28%)
Similarity:331/773 - (42%) Gaps:202/773 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 SIWQPAVQVEGRRQMANSQEMIKDHLG----ARSQNKTPAITNNANQSSTSSADLDDGAADDDDN 89
            ||.|....:||:.:||::..:....:.    ..:.||...:..|.:...|   |:.:|       
Human   504 SITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYIT---DVPNG------- 558

  Fly    90 KADLPVNVSSKPYWRNPKKMSFLQTRPSGSLLTLNCHALGNPEPNITWYRNGTVDWTRGYGSLKR 154
               ..||:...|              ..|..|.|:|........::||....||:....:.|:.:
Human   559 ---FHVNLEKMP--------------TEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISK 606

  Fly   155 NRWTLTMEDLVP----------GDCGNYTCKVCNSLGCIRHDTQVI----VSDRVNHKPILMTGP 205
            .:..:|.|..:.          .|.|.|.|:..|    :....:::    ::.|....|.|:...
Human   607 QKMAITKEHSITLNLTIMNVSLQDSGTYACRARN----VYTGEEILQKKEITIRDQEAPYLLRNL 667

  Fly   206 LNLTLVVNSTGSMHCKYLSDLTSKKAWIFVPCHGMTNCSNNRS-------IIAEDKDQLDFVNVR 263
            .:.|:.::|:.::.|....          ||...:|...||..       |:......|....|.
Human   668 SDHTVAISSSTTLDCHANG----------VPEPQITWFKNNHKIQQEPGIILGPGSSTLFIERVT 722

  Fly   264 MEQEGWYTCVESNSLGQSNSTAYLRVVRSLHVLEAGVASGSLHSTSFVYIFV----FGGLIFIFM 324
            .|.||.|.|..:|..|...|:|||.|            .|:...::...|.:    ....:|..:
Human   723 EEDEGVYHCKATNQKGSVESSAYLTV------------QGTSDKSNLELITLTCTCVAATLFWLL 775

  Fly   325 TTLFVFYAIRKMKHEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSMDTMIMPVVRIQKQRTTVL 389
            .|||    |||||.                            ||..:.|..:.::.         
Human   776 LTLF----IRKMKR----------------------------SSSEIKTDYLSIIM--------- 799

  Fly   390 QNGNEPAPFNEY--EFPLD-SNWELPRSHLVLGATLGEGAFGRVVMAEV-------NNAIVAVKM 444
              ..:..|.:|.  ..|.| |.||..|..|.||.:||.||||:||.|..       ....|||||
Human   800 --DPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGKVVQASAFGIKKSPTCRTVAVKM 862

  Fly   445 VKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCS-QNGPLYVIVEYAPHGNLKDFLYKNRPF 508
            :|||.|..:..:|:.|::::..||.|:|::||||.|: |.|||.|||||..:|||.::|...|..
Human   863 LKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVEYCKYGNLSNYLKSKRDL 927

  Fly   509 ------------------------GR-----------------------------DQDRDSSQPP 520
                                    |:                             ::|.|.....
Human   928 FFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDVEEEEDSDGFYKE 992

  Fly   521 PSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDI-QST 584
            |      ||.:|||.::.|:||||::|:||:||||||||||:|:|::.|:||.|||||||| ::.
Human   993 P------ITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKNP 1051

  Fly   585 DYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMS 649
            ||.||. :.|||:|||||||:.:|.|.:||||||||:|||||.:.|..|||.:...|:..:.|..
Human  1052 DYVRKG-DTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLRE 1115

  Fly   650 GQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTK-----EDYLDVD 702
            |.||..|...:..||.:|..|||.:..:||.|.|:||.:..|||..     :||:.::
Human  1116 GMRMRAPEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPIN 1173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 17/103 (17%)
Ig strand B 121..125 CDD:409353 2/3 (67%)
Ig strand C 134..138 CDD:409353 1/3 (33%)
Ig strand E 157..161 CDD:409353 0/3 (0%)
Ig strand F 171..176 CDD:409353 2/4 (50%)
Ig strand G 184..187 CDD:409353 0/2 (0%)
Ig 200..289 CDD:472250 23/95 (24%)
Ig strand B 216..220 CDD:409353 0/3 (0%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 1/2 (50%)
Protein Kinases, catalytic domain 404..692 CDD:473864 143/350 (41%)
FLT1NP_002010.2 IG_like 143..219 CDD:214653
IgI_VEGFR 230..330 CDD:409448
Ig strand A 230..234 CDD:409448
Ig strand A' 240..244 CDD:409448
Ig strand B 246..255 CDD:409448
Ig strand C 262..267 CDD:409448
Ig strand C' 270..272 CDD:409448
Ig strand D 275..283 CDD:409448
Ig strand E 290..298 CDD:409448
Ig strand F 308..314 CDD:409448
Ig strand G 319..325 CDD:409448
IgI_VEGFR-1 333..424 CDD:409499
Ig strand A 333..337 CDD:409499
Ig strand A' 343..348 CDD:409499
Ig strand B 353..361 CDD:409499
Ig strand C 365..371 CDD:409499
Ig strand C' 373..376 CDD:409499
Ig strand D 382..386 CDD:409499
Ig strand E 388..393 CDD:409499
Ig strand F 401..410 CDD:409499
Ig strand G 413..424 CDD:409499
Ig_3 427..539 CDD:464046 7/34 (21%)
IG_like 568..640 CDD:214653 15/71 (21%)
Ig strand B 573..577 CDD:409353 2/3 (67%)
Ig strand C 586..594 CDD:409353 2/7 (29%)
Ig strand E 619..623 CDD:409353 0/3 (0%)
Ig strand F 633..638 CDD:409353 2/4 (50%)
I-set 661..748 CDD:400151 24/96 (25%)
Ig strand B 679..682 CDD:409353 0/2 (0%)
Ig strand C 691..695 CDD:409353 1/3 (33%)
Ig strand E 714..718 CDD:409353 1/3 (33%)
Ig strand F 728..733 CDD:409353 2/4 (50%)
PTKc_VEGFR1 819..1157 CDD:271109 140/344 (41%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..982 1/41 (2%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.