DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Ret

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_033076.2 Gene:Ret / 19713 MGIID:97902 Length:1115 Species:Mus musculus


Alignment Length:363 Identity:156/363 - (42%)
Similarity:213/363 - (58%) Gaps:30/363 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   385 RTTVLQNGNEPAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMA-------EVNNAIVAV 442
            |...|.:.....|.:.::.|.|..||.||.:||||.|||||.||:||.|       ......|||
Mouse   694 RRPSLDSTENQVPVDSFKIPEDPKWEFPRKNLVLGKTLGEGEFGKVVKATAFRLKGRAGYTTVAV 758

  Fly   443 KMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRP 507
            ||:||..:..::..|:.|..::|.: .|.::|.|.|.|||:|||.:|||||.:|:|:.||..:|.
Mouse   759 KMLKENASQSELRDLLSEFNLLKQV-NHPHVIKLYGACSQDGPLLLIVEYAKYGSLRGFLRDSRK 822

  Fly   508 FG-----RDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDD 567
            .|     ....|:||. ...|...|:|..|||.||.||:|||.|||..:.:||||||||:||::.
Mouse   823 IGPAYVSGGGSRNSSS-LDHPDERVLTMGDLISFAWQISRGMQYLAEMKLVHRDLAARNILVAEG 886

  Fly   568 YVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQ 632
            ..:||:||||:||:...|.|.|.:.||:|:||||.|||.:..|.::|||||:|:|||||:|.|..
Mouse   887 RKMKISDFGLSRDVYEEDSYVKKSKGRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVTLGGN 951

  Fly   633 PYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKED 697
            |||.| ..|.|:..|.:|.|||:|..||..:|.||.|||....|.||.|.:|.:.::|::....|
Mouse   952 PYPGI-PPERLFNLLKTGHRMERPDNCSEEMYRLMLQCWKQEPDKRPVFADISKDLEKMMVKSRD 1015

  Fly   698 YLDVDIANLDTPPST-------SDEEEDETDNLQKWCN 728
            |||:..:   ||..:       |:||....|     ||
Mouse  1016 YLDLAAS---TPSDSLLYDDGLSEEETPLVD-----CN 1045

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 141/299 (47%)
RetNP_033076.2 RET_CLD1 29..154 CDD:465485
Cadherin-like region 1 (CLD1). /evidence=ECO:0000250|UniProtKB:P07949 29..153
Cadherin 173..262 CDD:394985
Cadherin-like region 3 (CLD3). /evidence=ECO:0000250|UniProtKB:P07949 266..380
RET_CLD3 266..380 CDD:465516
Cadherin-like region 4 (CLD4). /evidence=ECO:0000250|UniProtKB:P07949 407..508
RET_CLD4 409..508 CDD:465517
PTKc_RET 724..1013 CDD:173631 135/291 (46%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.