DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and R151.1

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001299880.1 Gene:R151.1 / 187907 WormBaseID:WBGene00020106 Length:696 Species:Caenorhabditis elegans


Alignment Length:424 Identity:139/424 - (32%)
Similarity:223/424 - (52%) Gaps:73/424 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   302 SGS-------LHSTSFVYIFVFGGLIFIFMTTLFVFYAIRKMKHEKVLKQRIETVHQWTKKVIIF 359
            |||       |..:|.:.||:........:.|:.|...:|:.|.|  :|:|...:|:.:      
 Worm   325 SGSAITKTTMLMESSILVIFLIVVACMSPICTMIVLLCLRRRKKE--IKKRHHFLHRRS------ 381

  Fly   360 KPEGGGDSSGSMDTMIMPVVRIQKQRTTVLQNGNEPAPFNEYEFPLDSNWELPRSHLVLGATLGE 424
                                 :...|.::::......|.||........|.:....:|:||.:||
 Worm   382 ---------------------LSCSRHSIIETNILYRPPNEVNGGTTGEWLIRGQDIVVGAVIGE 425

  Fly   425 GAFGRV---VMAEVNNAI--VAVKMVKEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQNG 484
            ||||:|   ::...|..:  ||||.:|....|::....|||:::|:.:|:|.||:.:.|.|....
 Worm   426 GAFGQVFKGILRGPNGQVIPVAVKQLKANAIDEEREEFVREIQMMQTVGQHDNIVTMYGYCMDEQ 490

  Fly   485 PLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLAS 549
            ...:|:||.|:|:||.:|...|   :::|.||:          |..|:.:.|.:|||.||.:|.|
 Worm   491 LQCMIMEYVPYGDLKHYLQNMR---KEKDSDSA----------IDSKEFLSFTNQIACGMAHLES 542

  Fly   550 RRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKS 614
            ...|||||||||:||....||||:|||::|    ...|.|.:.|.:|::|::||::::..|.:||
 Worm   543 VGIIHRDLAARNILVGTGKVLKISDFGMSR----PGVYIKMSKGVIPLRWLSPEAIKDNTYSNKS 603

  Fly   615 DVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRP 679
            |||::|:|||||.|.|..||..: :.:::...|..|.|:|:|||||.::||||:.||:..|:|||
 Worm   604 DVWAFGVLLWEIATLGGFPYNNV-ADKDILNQLTEGMRLEQPAKCSDDMYILMKSCWNLKAEDRP 667

  Fly   680 PFTEIVEYMDKLLQTKEDYLDVDIANL--DTPPS 711
            .|..|:..:::            |||:  |.|||
 Worm   668 SFLAILSKIEQ------------IANVDADAPPS 689

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 113/292 (39%)
STYKc 416..688 CDD:214568 112/276 (41%)
R151.1NP_001299880.1 PTKc 422..677 CDD:270623 109/272 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.