DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and C18H7.4

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_499953.2 Gene:C18H7.4 / 182803 WormBaseID:WBGene00015994 Length:390 Species:Caenorhabditis elegans


Alignment Length:279 Identity:82/279 - (29%)
Similarity:146/279 - (52%) Gaps:30/279 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   422 LGEGAFGRVVMAEV--NNAIVAVKMV-KEGHTDDDIASLVREMEVMKIIGRHINIINLLGCCSQN 483
            :|.||:|.|....:  .|||||||.: .||..::.:..:::|..||::.. |.||:...|....:
 Worm   128 IGSGAYGTVYRGRLVKTNAIVAVKKLDTEGTDEEGLTDMMKEARVMQLYD-HPNIVKFYGYILDD 191

  Fly   484 GPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLA 548
            .|..:::|:...|:::|.|       ||:           |...|..:  :::.:..|.|||||.
 Worm   192 VPYLLVLEFCNGGSVEDLL-------RDK-----------PEIKINRR--VQYTYMAACGMDYLH 236

  Fly   549 SRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSK 613
            .:.|||||:|:||.|:.:. |:|:||||:.|   :|..|:.:.:..|.::|:|||..........
 Worm   237 KKNCIHRDIASRNCLIHNG-VVKMADFGMCR---ATAVYKVDLSKPLNVRWLAPEVWTNGETRYN 297

  Fly   614 SDVWSYGILLWE-IMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIYILMRQCWHFNADD 677
            :||:::|:::|| .:|..|.|| |......:...:..|.||:.|.....::..|:.:||:.:.:.
 Worm   298 TDVYAFGVMIWEFFITPYQSPY-TEWKGYTVKQKVRGGYRMQPPEGMPKDVASLLAECWNHDPEK 361

  Fly   678 RPPFTEIVEYMDKLLQTKE 696
            ||...::.|.::.|.|..|
 Worm   362 RPNAEKLKEKLEDLNQKYE 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 79/273 (29%)
C18H7.4NP_499953.2 SH2_Fps_family 11..99 CDD:198224
PK_Tyr_Ser-Thr 122..372 CDD:462242 79/269 (29%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.