DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and F09A5.2

DIOPT Version :9

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001360730.1 Gene:F09A5.2 / 181440 WormBaseID:WBGene00008599 Length:867 Species:Caenorhabditis elegans


Alignment Length:354 Identity:119/354 - (33%)
Similarity:184/354 - (51%) Gaps:50/354 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 WELPRSHLVL--GATLGEGAF---------GRVVMAEVNNAI-VAVKMVKEGHTDDDIASL---- 457
            ||:...:|::  ...||.|||         |::.:..|||:: :.|:....||.:..|..|    
 Worm   458 WEIDTKNLLVQEDHLLGNGAFANVYKGIVKGKIPLLVVNNSLNMTVESENNGHYEAAIKKLPAHA 522

  Fly   458 --------VREMEVMKIIGRHINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDR 514
                    ..|::.||.:|.|.::|::|||.|......::|||...|:|..||.:::.:......
 Worm   523 DEQNHLDFFHEIDFMKRLGHHPHVISMLGCVSNPYEPLIVVEYCARGDLLKFLRRHKDYVLMNKT 587

  Fly   515 DSSQPPPSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLAR 579
            |..   |......:..|||:..|.|:|.||.||||:..|||||||||:|::.....|::||||.|
 Worm   588 DDC---PIEADMCLRIKDLVSIAWQVADGMSYLASKNFIHRDLAARNILLTKSLTAKVSDFGLCR 649

  Fly   580 DIQSTDYYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELY 644
            .:.|..|..|  .||||||||:.|:|:...:.:|:||||:|:||:||.:.|..|||||...:.| 
 Worm   650 YMDSALYTAK--GGRLPIKWMSVEALKLYEFSTKTDVWSFGVLLFEIFSMGDVPYPTIQQVDML- 711

  Fly   645 TYLMSGQRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKED---YLDV----- 701
            .:|::|.|:.:|.||...|:.:|::||....:|||.|.|:...:..:|...::   ||.|     
 Worm   712 EHLLAGGRLSQPLKCPNEIFNIMQKCWAEKPEDRPEFNEMRGEITVMLNLDDESYGYLSVESQGG 776

  Fly   702 ------------DIANLDTPPSTSDEEED 718
                        :.|...||..:.|.:||
 Worm   777 PKYTQLTMQDSKETAPCSTPGGSQDMDED 805

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 112..191 CDD:299845
IG_like 113..191 CDD:214653
IG_like 205..289 CDD:214653
PKc_like 404..692 CDD:304357 109/306 (36%)
STYKc 416..688 CDD:214568 107/295 (36%)
F09A5.2NP_001360730.1 PTKc 473..752 CDD:270623 106/284 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0200
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.