| Sequence 1: | NP_524394.2 | Gene: | htl / 42160 | FlyBaseID: | FBgn0010389 | Length: | 729 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_497162.2 | Gene: | ver-1 / 175182 | WormBaseID: | WBGene00006894 | Length: | 1083 | Species: | Caenorhabditis elegans |
| Alignment Length: | 37 | Identity: | 13/37 - (35%) |
|---|---|---|---|
| Similarity: | 21/37 - (56%) | Gaps: | 2/37 - (5%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 350 GNRYYNMT-IMGILKFILGFTPFFLNRFLTKRAIAIS 385 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| htl | NP_524394.2 | Ig | 101..191 | CDD:472250 | |
| Ig strand B | 121..125 | CDD:409353 | |||
| Ig strand C | 134..138 | CDD:409353 | |||
| Ig strand E | 157..161 | CDD:409353 | |||
| Ig strand F | 171..176 | CDD:409353 | |||
| Ig strand G | 184..187 | CDD:409353 | |||
| Ig | 200..289 | CDD:472250 | |||
| Ig strand B | 216..220 | CDD:409353 | |||
| Ig strand C | 229..233 | CDD:409353 | |||
| Ig strand E | 255..259 | CDD:409353 | |||
| Ig strand F | 269..274 | CDD:409353 | |||
| Ig strand G | 282..285 | CDD:409353 | |||
| Protein Kinases, catalytic domain | 404..692 | CDD:473864 | |||
| ver-1 | NP_497162.2 | IG_like | 578..654 | CDD:214653 | |
| Ig strand B | 582..586 | CDD:409353 | |||
| Ig strand C | 596..600 | CDD:409353 | |||
| Ig strand E | 619..623 | CDD:409353 | |||
| Ig strand F | 633..638 | CDD:409353 | |||
| Ig strand G | 647..650 | CDD:409353 | |||
| Ig | 663..731 | CDD:472250 | |||
| Ig strand B | 674..677 | CDD:409565 | |||
| Ig strand C | 686..690 | CDD:409565 | |||
| Ig strand F | 712..717 | CDD:409565 | |||
| Ig strand G | 725..728 | CDD:409565 | |||
| PTKc | 807..1073 | CDD:270623 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||