DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and ver-1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_497162.2 Gene:ver-1 / 175182 WormBaseID:WBGene00006894 Length:1083 Species:Caenorhabditis elegans


Alignment Length:37 Identity:13/37 - (35%)
Similarity:21/37 - (56%) Gaps:2/37 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 GNRYYNMT-IMGILKFILGFTPFFLNRFLTKRAIAIS 385
            ||:.:|.. :..:|:.|.||:| ..|.||..|::..|
 Worm   279 GNKDWNCARLSPVLRDINGFSP-ETNNFLPARSVVNS 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864
ver-1NP_497162.2 IG_like 578..654 CDD:214653
Ig strand B 582..586 CDD:409353
Ig strand C 596..600 CDD:409353
Ig strand E 619..623 CDD:409353
Ig strand F 633..638 CDD:409353
Ig strand G 647..650 CDD:409353
Ig 663..731 CDD:472250
Ig strand B 674..677 CDD:409565
Ig strand C 686..690 CDD:409565
Ig strand F 712..717 CDD:409565
Ig strand G 725..728 CDD:409565
PTKc 807..1073 CDD:270623
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.