DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Kit

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_001116205.1 Gene:Kit / 16590 MGIID:96677 Length:979 Species:Mus musculus


Alignment Length:169 Identity:27/169 - (15%)
Similarity:58/169 - (34%) Gaps:42/169 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   263 LQNDAKKIALQITLLNNNRDIEEDDISILSWHEILGFSAPTHTDEKKTWKTLFKST--RFLKPTA 325
            |.||.|...|:.::..::         :.:||:                 .||:|:  .|:...:
Mouse   294 LPNDGKMKELEESICRHH---------LKNWHD-----------------KLFRSSVDLFMPKFS 332

  Fly   326 VMCYSFMASSIVSFGFYFSIDVLPGNRYYNMTIMGILKFILGFTPFFLNRFLTKRAIAISSVGLC 390
            :...|.:...::..|...:.|       |.....|:.:.:    ...::|.|.:..:::...|  
Mouse   333 ISATSKLDDILMDMGMTDAFD-------YKADFSGMTEEV----KVRVSRVLHQAVMSVDEKG-- 384

  Fly   391 CLAALMILPIQYYDIQCMRWVIIMLSLMIAAGIDPTWKI 429
             ..|..|..|:...:.....||:....::....|.|..|
Mouse   385 -TEAAAITTIEIMPMSLPHTVILNRPFLVLIVEDSTMSI 422

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250 5/25 (20%)
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353 1/4 (25%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864 5/26 (19%)
KitNP_001116205.1 ig 217..308 CDD:395002 5/13 (38%)
Ig strand B 230..234 CDD:409353
Ig strand C 244..248 CDD:409353
Ig strand E 276..280 CDD:409353
Ig strand G 300..306 CDD:409353 1/5 (20%)
IgI_4_SCFR 314..414 CDD:409446 19/130 (15%)
Ig strand A 314..320 CDD:409446 2/22 (9%)
Ig strand A' 324..329 CDD:409446 1/4 (25%)
Ig strand B 332..342 CDD:409446 1/9 (11%)
Ig strand C 346..353 CDD:409446 1/6 (17%)
Ig strand C' 355..358 CDD:409446 0/2 (0%)
Ig strand D 361..366 CDD:409446 0/8 (0%)
Ig strand E 375..384 CDD:409446 0/8 (0%)
Ig strand F 391..399 CDD:409446 1/7 (14%)
Ig strand G 402..413 CDD:409446 2/10 (20%)
Ig 429..505 CDD:409353
Ig strand C 440..444 CDD:409353
Ig strand E 473..481 CDD:409353
Ig strand F 491..496 CDD:409353
PTKc_Kit 556..930 CDD:270682
Important for interaction with phosphotyrosine-binding proteins. /evidence=ECO:0000250 571..573
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.