DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and CSK

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_004374.1 Gene:CSK / 1445 HGNCID:2444 Length:450 Species:Homo sapiens


Alignment Length:40 Identity:9/40 - (22%)
Similarity:18/40 - (45%) Gaps:8/40 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 EEESIRLDVSSVSSDKVATEQRDDKGPLKLTEPRKRMRED 42
            |:|    :..:.:..:||.:..||....|    :::..||
Human    79 EDE----EAEAPTGKRVAEDDEDDDVDTK----KQKTEED 110

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864
CSKNP_004374.1 Interaction with PTPN22. /evidence=ECO:0000250|UniProtKB:P41241 9..70
SH3_CSK 11..67 CDD:212703
SH2_csk_like 78..175 CDD:198190 9/40 (23%)
PTKc_Csk 188..443 CDD:133213
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.