DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Csk

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_031809.2 Gene:Csk / 12988 MGIID:88537 Length:450 Species:Mus musculus


Alignment Length:374 Identity:126/374 - (33%)
Similarity:190/374 - (50%) Gaps:57/374 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   329 VFYAIRKMK--HEKVLKQRIETVHQWTKKVIIFKPEGGGDSSGSMDTMIMPVVRIQKQRTTVLQN 391
            :.|...|:.  .|...:..::.|..:|.           |:.|....:|.|.|   .:.|...|:
Mouse   131 IMYHASKLSIDEEVYFENLMQLVEHYTT-----------DADGLCTRLIKPKV---MEGTVAAQD 181

  Fly   392 GNEPAPFNEYEFPLDSNWELPRSHLVLGATLGEGAFGRVVMAEVNNAIVAVKMVKEGHTDDDIAS 456
                      || ..|.|.|....|.|..|:|:|.||.|::.:.....||||.:|   .|....:
Mouse   182 ----------EF-YRSGWALNMKELKLLQTIGKGEFGDVMLGDYRGNKVAVKCIK---NDATAQA 232

  Fly   457 LVREMEVMKIIGRHINIINLLG-CCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPP 520
            .:.|..||..: ||.|::.||| ...:.|.||::.||...|:|.|:|   |..||.         
Mouse   233 FLAEASVMTQL-RHSNLVQLLGVIVEEKGGLYIVTEYMAKGSLVDYL---RSRGRS--------- 284

  Fly   521 PSPPAHVITEKDLIKFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTD 585
                  |:....|:||:..:...|:||.....:||||||||||||:|.|.|::||||.::..|| 
Mouse   285 ------VLGGDCLLKFSLDVCEAMEYLEGNNFVHRDLAARNVLVSEDNVAKVSDFGLTKEASST- 342

  Fly   586 YYRKNTNGRLPIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSG 650
                ...|:||:||.|||:|:||.:.:||||||:|||||||.::|:.|||.| ..:::...:..|
Mouse   343 ----QDTGKLPVKWTAPEALREKKFSTKSDVWSFGILLWEIYSFGRVPYPRI-PLKDVVPRVEKG 402

  Fly   651 QRMEKPAKCSMNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKEDYL 699
            .:|:.|..|...:|.:|:.|||.:|..||.|.::.|.::. ::|.|.:|
Mouse   403 YKMDAPDGCPPAVYEVMKNCWHLDAATRPTFLQLREQLEH-IKTHELHL 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 109/288 (38%)
CskNP_031809.2 Interaction with PTPN22. /evidence=ECO:0000269|PubMed:8890164 9..70
SH3_CSK 11..67 CDD:212703
SH2_csk_like 78..175 CDD:198190 10/57 (18%)
PTKc_Csk 188..443 CDD:133213 108/283 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.