DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Btk29A

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_061512228.1 Gene:Btk29A / 1277670 VectorBaseID:AGAMI1_007842 Length:810 Species:Anopheles gambiae


Alignment Length:297 Identity:105/297 - (35%)
Similarity:157/297 - (52%) Gaps:37/297 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   409 WELPRSHLVLGATLGEGAFGRVVMAEVNNAI-VAVKMVKEGHTDDDIASLVREMEVMKIIGRHIN 472
            ||:..|.|::...||.|.||.|..|:...:| .||||:|.|...:|  ..:.|.:||..: :|.|
Mosquito   543 WEIHPSELMILEELGSGQFGVVRRAKWRGSIDTAVKMMKVGTMSED--DFIEEAKVMTKL-QHPN 604

  Fly   473 IINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLI--- 534
            ::.|.|.||::.|:|:|.||..||:|.::|.::                        |:.||   
Mosquito   605 LVQLYGVCSKHRPIYIITEYMKHGSLLNYLRRH------------------------EQSLIGNM 645

  Fly   535 ----KFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRL 595
                ....|:.:||.||.....|||||||||.||..:..:|:|||||||.:.. |.|..:...:.
Mosquito   646 GLLLDMCIQVCKGMSYLERHNYIHRDLAARNCLVGSENTVKVADFGLARYVLD-DQYTSSGGTKF 709

  Fly   596 PIKWMAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCS 660
            ||||..||.|....:.||||||:||:|:||:.|.|:.||..:.:. |:...:..|..:|||..|:
Mosquito   710 PIKWAPPEVLNYTRFSSKSDVWAYGVLMWEVFTCGKMPYGRLKNT-EVVERVQRGIILEKPKACA 773

  Fly   661 MNIYILMRQCWHFNADDRPPFTEIVEYMDKLLQTKED 697
            ..||.:|::||..:.:|||.|..:.:.:..:.|...|
Mosquito   774 KEIYDVMKKCWSHSPEDRPGFRILKDQLAAVAQGLTD 810

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250
Ig strand B 121..125 CDD:409353
Ig strand C 134..138 CDD:409353
Ig strand E 157..161 CDD:409353
Ig strand F 171..176 CDD:409353
Ig strand G 184..187 CDD:409353
Ig 200..289 CDD:472250
Ig strand B 216..220 CDD:409353
Ig strand C 229..233 CDD:409353
Ig strand E 255..259 CDD:409353
Ig strand F 269..274 CDD:409353
Ig strand G 282..285 CDD:409353
Protein Kinases, catalytic domain 404..692 CDD:473864 103/290 (36%)
Btk29AXP_061512228.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.