DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and Fgfrl1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:NP_473412.1 Gene:Fgfrl1 / 116701 MGIID:2150920 Length:529 Species:Mus musculus


Alignment Length:299 Identity:84/299 - (28%)
Similarity:129/299 - (43%) Gaps:35/299 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 GARSQNKTPAITNNANQSSTSSADLDDGAADDDDNKADLPVNVSSKPYWRNPKKM-SFLQTRPSG 118
            |:.|.|.|..|.::.:....|     .|.......:.|......::|.:..|.|| ..:..||.|
Mouse   102 GSLSVNYTLIIMDDISPGKES-----PGPGGSSGGQEDPASQQWARPRFTQPSKMRRRVIARPVG 161

  Fly   119 SLLTLNCHALGNPEPNITWYRNGTVDWTRGY---GSLKRNRWTLTMEDLVPGDCGNYTCKVCNSL 180
            |.:.|.|.|.|:|.|:|.|.::   |.|..:   ...::.:|||::::|.|.|.|.|||:|.|..
Mouse   162 SSVRLKCVASGHPRPDIMWMKD---DQTLTHLEASEHRKKKWTLSLKNLKPEDSGKYTCRVSNKA 223

  Fly   181 GCIRHDTQVIVSDRVNHKPILM-TGPLNLTLVVNSTGSMHCKYLSDLTSKKAWIFVPCHGMTNCS 244
            |.|....:|.|..|...||:|. |.|:|.|:....|.|..||..||:.....|:....:|.....
Mouse   224 GAINATYKVDVIQRTRSKPVLTGTHPVNTTVDFGGTTSFQCKVRSDVKPVIQWLKRVEYGSEGRH 288

  Fly   245 NNRSIIAEDK------------------DQLDFVNVRMEQEGWYTCVESNSLGQSNSTAYLRVVR 291
            |:...:...|                  ::|.....|.:..|.|.|:.:|::|.|..:|:|.|:.
Mouse   289 NSTIDVGGQKFVVLPTGDVWSRPDGSYLNKLLISRARQDDAGMYICLGANTMGYSFRSAFLTVLP 353

  Fly   292 SLHVLEAGVASGSLHSTSFVYIFVFG---GLIFIFMTTL 327
            ........:||.| .|||..:..|.|   |.:||..|.|
Mouse   354 DPKPPGPPMASSS-SSTSLPWPVVIGIPAGAVFILGTVL 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 33/93 (35%)
Ig strand B 121..125 CDD:409353 1/3 (33%)
Ig strand C 134..138 CDD:409353 1/3 (33%)
Ig strand E 157..161 CDD:409353 3/3 (100%)
Ig strand F 171..176 CDD:409353 3/4 (75%)
Ig strand G 184..187 CDD:409353 0/2 (0%)
Ig 200..289 CDD:472250 25/107 (23%)
Ig strand B 216..220 CDD:409353 1/3 (33%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 1/3 (33%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864
Fgfrl1NP_473412.1 I-set 29..112 CDD:400151 4/9 (44%)
Ig strand B 43..47 CDD:409353
Ig strand C 56..60 CDD:409353
Ig strand E 78..82 CDD:409353
Ig strand F 92..97 CDD:409353
Ig strand G 105..108 CDD:409353 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 116..151 5/39 (13%)
IgI_2_FGFRL1-like 143..234 CDD:409442 33/93 (35%)
Ig strand A 143..146 CDD:409442 1/2 (50%)
Ig strand A' 154..159 CDD:409442 0/4 (0%)
Ig strand B 163..171 CDD:409442 2/7 (29%)
Ig strand C 177..182 CDD:409442 2/4 (50%)
Ig strand C' 185..187 CDD:409442 0/1 (0%)
Ig strand D 193..196 CDD:409442 0/2 (0%)
Ig strand E 200..205 CDD:409442 3/4 (75%)
Ig strand F 214..221 CDD:409442 4/6 (67%)
Ig strand G 224..234 CDD:409442 3/9 (33%)
Ig 242..350 CDD:472250 25/107 (23%)
Ig strand B 260..264 CDD:409353 1/3 (33%)
Ig strand C 273..277 CDD:409353 0/3 (0%)
Ig strand E 317..321 CDD:409353 1/3 (33%)
Ig strand F 331..336 CDD:409353 2/4 (50%)
Ig strand G 344..347 CDD:409353 0/2 (0%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 405..427
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.