DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment htl and ntrk1

DIOPT Version :10

Sequence 1:NP_524394.2 Gene:htl / 42160 FlyBaseID:FBgn0010389 Length:729 Species:Drosophila melanogaster
Sequence 2:XP_002939035.2 Gene:ntrk1 / 100489637 XenbaseID:XB-GENE-923001 Length:808 Species:Xenopus tropicalis


Alignment Length:687 Identity:181/687 - (26%)
Similarity:277/687 - (40%) Gaps:200/687 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   118 GSLLTLNCHALGNPEPNITWYRNGTVDWTR-GYGSLKRNRWTLTMEDLVPG-DCGNYTCKVCNSL 180
            |:.|||.|:..|.|.|..||.......:|. |..:.......|.:.::.|| :..|.||:..|.:
 Frog   217 GANLTLVCNVDGQPTPTATWIVPEMDSYTEIGQSNGSETEIFLPLFNISPGFNKRNVTCRAENMV 281

  Fly   181 GCIRHDTQ---------VIVSDRV-------------NHKP----------ILMTGPLNLTLV-- 211
            |......|         |.:.:.:             |.||          :.|...:.|..|  
 Frog   282 GPSEEHVQINVLFPAMVVALEEAIPQHHFCFPYTVDGNPKPEIRWQFNGHNLEMNDYIYLKTVEE 346

  Fly   212 -VNSTGSMHCKYLSDLTSKKAWIFVPCHGMTNCSNNRSIIAEDKDQLDFVNVRMEQEGWYTCVES 275
             .|||....|.||:.          |.|                     ||     .|.||.:..
 Frog   347 SENSTAIHGCLYLNK----------PTH---------------------VN-----NGNYTILVW 375

  Fly   276 NSLGQSNSTAYLRVVRSLHVLEAGVASGSLHSTSFVYIFVFGGLIFIFMTTLFVFYAIRKMKHEK 340
            |.||.::.|.|.:                                  ||...|.|      ..|:
 Frog   376 NMLGSASETVYSK----------------------------------FMDNPFSF------NPEE 400

  Fly   341 VLKQRIETVHQWTKKVIIFKPEGGGDS--SGSMDT---------------------MIMPVVRIQ 382
            .:.             :...|||||:|  :.:::|                     :::.::.:.
 Frog   401 PIP-------------VSLSPEGGGNSTYTTTVETVEENTFGVSVAVGLAVFACLFLLLILIALN 452

  Fly   383 K---------QRTTVLQNGNEPA-----------PFNEYEFPLDS---NW-------------EL 411
            |         .|..||...::.|           |....|..||.   |:             .:
 Frog   453 KCGRHSKFGINRAAVLAQEDDLAMSLHFMNFGTSPLTSAEGKLDGMKPNFIENPQYFCDACVQHI 517

  Fly   412 PRSHLVLGATLGEGAFGRVVMAEVNN-------AIVAVKMVKEGHTDDDIASLVREMEVMKIIGR 469
            .|..:||...|||||||:|.:||..|       .:||||.:||. |::......||.|::.:: :
 Frog   518 KRRDIVLKWELGEGAFGKVFLAEFYNLTPENEKTLVAVKALKEA-TENARQDFQREAELLTVL-Q 580

  Fly   470 HINIINLLGCCSQNGPLYVIVEYAPHGNLKDFLYKNRPFGRDQDRDSSQPPPSPPAHVITEKDLI 534
            |.:|:...|.|:...||.::.||..||:|..||..:.|..:..|..:.||...     :....::
 Frog   581 HEHIVKFYGVCTDGEPLIMVFEYMKHGDLNRFLRSHGPDAKILDNGNGQPYGQ-----LNLTQML 640

  Fly   535 KFAHQIARGMDYLASRRCIHRDLAARNVLVSDDYVLKIADFGLARDIQSTDYYRKNTNGRLPIKW 599
            :.|.|||.||.||||...:|||||.||.||.::.|:||.|||::|||.||||||......|||:|
 Frog   641 QIASQIASGMVYLASLHFVHRDLATRNCLVGNNLVVKIGDFGMSRDIYSTDYYRVGGRTMLPIRW 705

  Fly   600 MAPESLQEKFYDSKSDVWSYGILLWEIMTYGQQPYPTIMSAEELYTYLMSGQRMEKPAKCSMNIY 664
            |.|||:..:.:.::||:||:|::||||.|||:||:..:.:.|.: ..:..|:::|:|..|...:|
 Frog   706 MPPESILYRKFTTESDIWSFGVVLWEIFTYGKQPWYQLSNTEAI-ECITQGRQLERPRTCPTEVY 769

  Fly   665 ILMRQCWHFNADDRPPFTEIVEYMDKLLQTKEDYLDV 701
            .:|:.||......|....||...:..|::....|||:
 Frog   770 NIMQGCWQREPQQRLNIKEIHNKLQALVKAPPVYLDI 806

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
htlNP_524394.2 Ig 101..191 CDD:472250 22/83 (27%)
Ig strand B 121..125 CDD:409353 3/3 (100%)
Ig strand C 134..138 CDD:409353 1/3 (33%)
Ig strand E 157..161 CDD:409353 1/3 (33%)
Ig strand F 171..176 CDD:409353 3/4 (75%)
Ig strand G 184..187 CDD:409353 0/2 (0%)
Ig 200..289 CDD:472250 21/91 (23%)
Ig strand B 216..220 CDD:409353 0/3 (0%)
Ig strand C 229..233 CDD:409353 0/3 (0%)
Ig strand E 255..259 CDD:409353 0/3 (0%)
Ig strand F 269..274 CDD:409353 2/4 (50%)
Ig strand G 282..285 CDD:409353 0/2 (0%)
Protein Kinases, catalytic domain 404..692 CDD:473864 112/310 (36%)
ntrk1XP_002939035.2 LRR_8 97..156 CDD:404697
leucine-rich repeat 99..122 CDD:275378
leucine-rich repeat 123..145 CDD:275378
LRRCT_2 157..201 CDD:465313
Ig 211..292 CDD:472250 21/74 (28%)
Ig strand B 220..224 CDD:409353 3/3 (100%)
Ig strand C 233..237 CDD:409353 1/3 (33%)
Ig strand E 257..261 CDD:409353 1/3 (33%)
Ig strand F 272..277 CDD:409353 3/4 (75%)
Ig strand G 285..288 CDD:409353 0/2 (0%)
Ig 295..390 CDD:472250 25/164 (15%)
Ig strand B 310..314 CDD:409353 0/3 (0%)
Ig strand C 323..327 CDD:409353 0/3 (0%)
Ig strand E 355..359 CDD:409353 1/3 (33%)
Ig strand F 369..374 CDD:409353 2/4 (50%)
Ig strand G 382..385 CDD:409353 0/2 (0%)
PTKc_TrkA 516..795 CDD:270674 109/286 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.