DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP3K4 and Pak3

DIOPT Version :9

Sequence 1:NP_005913.3 Gene:MAP3K4 / 4216 HGNCID:6856 Length:1608 Species:Homo sapiens
Sequence 2:NP_001262638.1 Gene:Pak3 / 41995 FlyBaseID:FBgn0044826 Length:583 Species:Drosophila melanogaster


Alignment Length:461 Identity:122/461 - (26%)
Similarity:202/461 - (43%) Gaps:88/461 - (19%)


- Green bases have known domain annotations that are detailed below.


Human  1198 AAVAASRPSPSG-GDSVLPKSISSAHDTRGSSVPENDRLASIAAELQFRSLSRHSSPTEERDEPA 1261
            ::.|....|.|| |.|....:.||.:|:...|....|.|..:..||:.....|.:.....::.|.
  Fly   126 SSTATETESSSGCGSSAGNSNSSSINDSSQQSTVPLDALEEVFKELKTNLEHRETLKAAPQEPPP 190

Human  1262 YP------------------------------RGDSSGSTRRSWELRTLISQ----SKDTASKLG 1292
            .|                              |.|.....:......|:|.:    ::|..:...
  Fly   191 VPPKKSPHTIPPKPQIKPKPRVTQKFSRTSDIRRDEDSDNQHKINTDTIIIKPAVGAQDAGADDN 255

Human  1293 PIEAIQKSVRLFEEKR--------YREMRRKNIIGQVC--DTPKSYDNVMHVGLRKVTFKWQRGN 1347
            |.|.|   :|..:|||        |.|:|      .:|  |.|:.              :::...
  Fly   256 PDETI---LRRSKEKRAQKTDAEIYVELR------AICNSDDPRE--------------RYKTTQ 297

Human  1348 KIGEGQYGKVYTCISVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVEL-- 1410
            ::|:|..|.|:....:.....:|:|.|..:....|.:..|  |:::.:...|.|||.:....|  
  Fly   298 EVGKGASGIVFIAADLQNESQVAVKTIDMKNQSSKDLILT--EIRVLKDFNHKNLVNFLDAYLLE 360

Human  1411 HREEMYIFMEYCDEGTLEE-VSRLGLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSS 1474
            ..:::::.|||.|.|.|.: |:...::|..|....::...||:.||..||:|||||..|:.|...
  Fly   361 PEDQLWVVMEYMDGGPLTDVVTETVMKERQIACVCRETLYAISFLHAKGIIHRDIKSDNVLLGMD 425

Human  1475 GLIKLGDFGCSVKLKNN--AQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIE 1537
            |.:|:.|||....::.:  .|||       :||..:|||||:||.|   :|:..||||:|.:.||
  Fly   426 GSVKVTDFGFCANIEGDEKRQTM-------VGTPYWMAPEVVTRKK---YGKKVDIWSIGIMAIE 480

Human  1538 MVTGKRPWHEYEHNFQIMYKVGMGHKPPIP--ERLSPEGKDFLSHCLESDPKMRWTASQLLDHSF 1600
            |:.|:.| :.||...:.:|.:....:|.|.  ::|||..:|||..||:.:...|.||.:||.|.|
  Fly   481 MIEGQPP-YLYETPLRALYLIAANGRPDIKSWDKLSPNLQDFLDRCLQVEVDRRATADELLSHPF 544

Human  1601 VKVCTD 1606
            :..|::
  Fly   545 LNDCSE 550

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP3K4NP_005913.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1157..1190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1202..1231 9/29 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1244..1274 5/59 (8%)
STKc_MEKK4 1342..1601 CDD:270796 85/265 (32%)
Pak3NP_001262638.1 PBD 19..73 CDD:279166
PKc_like 288..545 CDD:304357 86/283 (30%)
S_TKc 293..545 CDD:214567 85/264 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.