DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment MAP3K4 and hpo

DIOPT Version :9

Sequence 1:NP_005913.3 Gene:MAP3K4 / 4216 HGNCID:6856 Length:1608 Species:Homo sapiens
Sequence 2:NP_001261092.1 Gene:hpo / 37247 FlyBaseID:FBgn0261456 Length:669 Species:Drosophila melanogaster


Alignment Length:313 Identity:102/313 - (32%)
Similarity:156/313 - (49%) Gaps:42/313 - (13%)


- Green bases have known domain annotations that are detailed below.


Human  1297 IQKSVRLFEEKRYREMRRKNIIGQVCDTPKSYDNVMHVGLRKVTFKWQRGNKIGEGQYGKVYTCI 1361
            |..|...|:.|:..|       ..:...|:...::|:              |:|||.||.||..:
  Fly    17 ISSSCSFFKLKKLSE-------ESLLQPPEKVFDIMY--------------KLGEGSYGSVYKAV 60

Human  1362 SVDTGELMAMKEIRFQPNDHKTIKETADELKIFEGIKHPNLVRYFGVELHREEMYIFMEYCDEGT 1426
            ..::..::|:|.:..:.:.|:.||    |:.|.:....|.:|||:|....:.:::|.||||..|:
  Fly    61 HKESSSIVAIKLVPVESDLHEIIK----EISIMQQCDSPYVVRYYGSYFKQYDLWICMEYCGAGS 121

Human  1427 LEEVSRL---GLQEHVIRLYSKQITIAINVLHEHGIVHRDIKGANIFLTSSGLIKLGDFGCSVKL 1488
            :.::.||   .|.|..|..........:..||....:|||||.|||.|.:.|..||.|||.:.:|
  Fly   122 VSDIMRLRKKTLTEDEIATILSDTLQGLVYLHLRRKIHRDIKAANILLNTEGYAKLADFGVAGQL 186

Human  1489 KNNAQTMPGEVNSTLGTAAYMAPEVITRAKGEGHGRAADIWSLGCVVIEMVTGKRPWHEYEHNFQ 1553
               ..|| .:.|:.:||..:||||||...   |:...|||||||...:||..||.|:.|. |..:
  Fly   187 ---TDTM-AKRNTVIGTPFWMAPEVIEEI---GYDCVADIWSLGITALEMAEGKPPYGEI-HPMR 243

Human  1554 IMYKVGMGHKPP----IPERLSPEGKDFLSHCLESDPKMRWTASQLLDHSFVK 1602
            .::.:  ..|||    .|:|.|.|..||:|.||..:|..|.||::||:|.|::
  Fly   244 AIFMI--PQKPPPSFREPDRWSTEFIDFVSKCLVKEPDDRATATELLEHEFIR 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
MAP3K4NP_005913.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 429..478
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1157..1190
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1202..1231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1244..1274
STKc_MEKK4 1342..1601 CDD:270796 94/265 (35%)
hpoNP_001261092.1 STKc_MST1_2 38..293 CDD:132943 96/282 (34%)
S_TKc 42..293 CDD:214567 95/278 (34%)
Mst1_SARAH 608..655 CDD:288481
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.