DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7794 and TUBE1

DIOPT Version :9

Sequence 1:NP_650674.1 Gene:CG7794 / 42159 FlyBaseID:FBgn0038565 Length:455 Species:Drosophila melanogaster
Sequence 2:NP_057346.1 Gene:TUBE1 / 51175 HGNCID:20775 Length:475 Species:Homo sapiens


Alignment Length:474 Identity:133/474 - (28%)
Similarity:239/474 - (50%) Gaps:60/474 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 IQIHIGQAGVQIANACWELFCLEHGILANGRLTQSPMDDSFLTFF------------EFTSHQPC 60
            :.:.:||.|.||....|:|...||..:..    :...|::..:||            ..:..:.|
Human     5 VVVQVGQCGNQIGCCFWDLALREHAAVNQ----KGIYDEAISSFFRNVDTRVVGDGGSISKGKIC 65

  Fly    61 -VQPRLVMIDTEPTVIDEIRTGSYRNLFHPDTLITGKDDSGSNFARGYNLMASELLDRSMNAIRR 124
             ::.|.|:||.|..|::||..|..|::|....|||....||:|:|.|:.:..|...|:.:...|:
Human    66 SLKARAVLIDMEEGVVNEILQGPLRDVFDTKQLITDISGSGNNWAVGHKVFGSLYQDQILEKFRK 130

  Fly   125 VADRCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFL--VYPSPSISPVIVEPYN 187
            .|:.|..|:.|.:..::|||:||||||.:::.|.::|.:   |..|:  :|||.. ..||..|||
Human   131 SAEHCDCLQCFFIIHSMGGGTGSGLGTFLLKVLEDEFPE---VYRFVTSIYPSGE-DDVITSPYN 191

  Fly   188 ALLAAHFSMDCADVSFIVDNEALYDICA-----------NTLNVPAPTYTN-------------- 227
            ::||.....:.||....:||::|:||.:           .|...|....|:              
Human   192 SILAMKELNEHADCVLPIDNQSLFDIISKIDLMVNSGKLGTTVKPKSLVTSSSGALKKQHKKPFD 256

  Fly   228 -LNRIIAQVVSSFTASQRFGGGSTVSFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQ 291
             :|.|:|.::.:.|:|.||.|...:...|:..||||:|::||.:.:..||..::..........|
Human   257 AMNNIVANLLLNLTSSARFEGSLNMDLNEISMNLVPFPQLHYLVSSLTPLYTLTDVNIPPRRLDQ 321

  Fly   292 LTGQCFQMSNQMVRCNPSHGKYMASVLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTGFKIGV 356
            :....|...:|::|.:|.|..|:|..|:.||::..:::...:|.:|  .|.:||.|:..|:|..:
Human   322 MFSDAFSKDHQLLRADPKHSLYLACALMVRGNVQISDLRRNIERLK--PSLQFVSWNQEGWKTSL 384

  Fly   357 SPMPPYYVPGGDLAPTNRACVAISNNTNIRIAWCRLVNKFDKLYQRRAFVYHYVG-EGLEEGNFN 420
            ..:||        ...:.:.:|::|||.::..:..|..:|.:||:::|.::||:. ||:||..|.
Human   385 CSVPP--------VGHSHSLLALANNTCVKPTFMELKERFMRLYKKKAHLHHYLQVEGMEESCFT 441

  Fly   421 EASENICQLVHDYLEVDAS 439
            ||..::..|:.:|.::||:
Human   442 EAVSSLSALIQEYDQLDAT 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7794NP_650674.1 alpha_tubulin 5..436 CDD:276955 131/469 (28%)
PTZ00335 6..439 CDD:185562 132/472 (28%)
TUBE1NP_057346.1 epsilon_tubulin 2..457 CDD:276959 131/469 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.