DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7794 and TUBG2

DIOPT Version :9

Sequence 1:NP_650674.1 Gene:CG7794 / 42159 FlyBaseID:FBgn0038565 Length:455 Species:Drosophila melanogaster
Sequence 2:XP_024306462.1 Gene:TUBG2 / 27175 HGNCID:12419 Length:596 Species:Homo sapiens


Alignment Length:360 Identity:102/360 - (28%)
Similarity:173/360 - (48%) Gaps:39/360 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 EIIQIHIGQAGVQIANACWELFCLEHGILANGRLTQSPMD--DSFLTFFEFTSHQPCVQPRLVMI 68
            |||.:.:||.|.||....|:..|.||||...|.:.:...:  |....||.....:..: ||.|::
Human     4 EIITLQLGQCGNQIGFEFWKQLCAEHGISPEGIVEEFATEGTDRKDVFFYQADDEHYI-PRAVLL 67

  Fly    69 DTEPTVIDEIRTGSYRNLFHPDTLITGK--DDSGSNFARGYNLMASELLDRSMNAIRRVAD---- 127
            |.||.||..|....|..|::|:.:...:  ..:|:|:|.|:: ...::.:...:.|.|.||    
Human    68 DLEPRVIHSILNSPYAKLYNPENIYLSEHGGGAGNNWASGFS-QGEKIHEDIFDIIDREADGSDS 131

  Fly   128 -----RCRNLRGFLVFRAIGGGSGSGLGTRIMERLVEDFGKKMTVVEFLVYP-SPSISPVIVEPY 186
                 ..|.::||::..:|.||:|||||:.::|||.:.:.||: |..:.|:| ...:|.|:|:||
Human   132 LELQNSSRVIKGFVLCHSIAGGTGSGLGSYLLERLNDRYPKKL-VQTYSVFPYQDEMSDVVVQPY 195

  Fly   187 NALLAAHFSMDCADVSFIVDNEALYDICANTLNVPAPTYTNLNRIIAQVVSSFTASQRFGGGSTV 251
            |:||........||...::||.||..|..:.|::..|:::.:|::::.::|:.|.:.|:.|....
Human   196 NSLLTLKRLTQNADCVVVLDNTALNRIATDRLHIQNPSFSQINQLVSTIMSASTTTLRYPGYMNN 260

  Fly   252 SFQELQTNLVPYPRIHYPLINYAPLVPISHSQFVNMSTAQLTGQCFQMSNQMVRCNPSHGKYMAS 316
            ....|..:|:|.||:|:.:..|.||           :|.|.....|.:..|   ..|...:...|
Human   261 DLIGLIASLIPTPRLHFLMTGYTPL-----------TTDQSVRAAFSVPGQ---AGPGPSRPCPS 311

  Fly   317 VLLYRGDIAPNEINTALENIKRNRSFRFVDWSPTG 351
            :.|:     |.....||   .|.:.....||...|
Human   312 LSLF-----PTAPGAAL---CRPQGTALRDWHRAG 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7794NP_650674.1 alpha_tubulin 5..436 CDD:276955 102/360 (28%)
PTZ00335 6..439 CDD:185562 102/360 (28%)
TUBG2XP_024306462.1 gamma_tubulin 3..>293 CDD:276957 90/302 (30%)
INTAP 306..>379 CDD:318758 9/41 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5023
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.