DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7785 and SPRYD7

DIOPT Version :9

Sequence 1:NP_650673.1 Gene:CG7785 / 42158 FlyBaseID:FBgn0038564 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_065189.1 Gene:SPRYD7 / 57213 HGNCID:14297 Length:196 Species:Homo sapiens


Alignment Length:256 Identity:94/256 - (36%)
Similarity:126/256 - (49%) Gaps:66/256 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MFCCLRTCLNGGHIRKPTATSRLRE-PDVHLDAAHMGPDVILLSHQLRVTGTGGVLATAPLVQSK 64
            :.||||.|.:||     |....|:| |.|.||..|||.||:::.:..|:.||||.||:|||.|:|
Human     5 VLCCLRCCRDGG-----TGHIPLKEMPAVQLDTQHMGTDVVIVKNGRRICGTGGCLASAPLHQNK 64

  Fly    65 SYFEVKIQHGGSWSVGLATRQTDLSRKSGGGDRESWCLCSDNATRHNDREEFRPVVQSACTTQPA 129
            ||||.|||..|.|.:|:||::.:|::...|.|..|..:.:|.|..||:.|:.|            
Human    65 SYFEFKIQSTGIWGIGVATQKVNLNQIPLGRDMHSLVMRNDGALYHNNEEKNR------------ 117

  Fly   130 RTSNGILNNSAAKAAGLIAIEDLQQEDLLMTTGVASSDVDIGDSLIASPQRDFPDEGDIVGVAFD 194
                                                           .|....|.|||:||:.:|
Human   118 -----------------------------------------------LPANSLPQEGDVVGITYD 135

  Fly   195 HVELNFYFNGKNLEVPFRNVRGAALFPVIYVGNGAILDIILDNFSHGPPPGFERILLEQSL 255
            |||||.|.||||:..|...:|| .::||:||.:.||||.....|.|.||||||:||.||.:
Human   136 HVELNVYLNGKNMHCPASGIRG-TVYPVVYVDDSAILDCQFSEFYHTPPPGFEKILFEQQI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7785NP_650673.1 SPRYD7 35..256 CDD:293938 79/221 (36%)
SPRYD7NP_065189.1 SPRYD7 35..196 CDD:293938 79/221 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165149836
Domainoid 1 1.000 116 1.000 Domainoid score I5988
eggNOG 1 0.900 - - E1_KOG4030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10725
Inparanoid 1 1.050 193 1.000 Inparanoid score I3854
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48841
OrthoDB 1 1.010 - - D1278394at2759
OrthoFinder 1 1.000 - - FOG0006352
OrthoInspector 1 1.000 - - oto90119
orthoMCL 1 0.900 - - OOG6_106411
Panther 1 1.100 - - LDO PTHR20951
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3774
SonicParanoid 1 1.000 - - X4623
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.