DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7785 and spryd7a

DIOPT Version :9

Sequence 1:NP_650673.1 Gene:CG7785 / 42158 FlyBaseID:FBgn0038564 Length:256 Species:Drosophila melanogaster
Sequence 2:NP_999941.1 Gene:spryd7a / 407615 ZFINID:ZDB-GENE-040426-2713 Length:196 Species:Danio rerio


Alignment Length:256 Identity:89/256 - (34%)
Similarity:118/256 - (46%) Gaps:70/256 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 CCLRTC--LNGGHIRKPTATSRLRE-PDVHLDAAHMGPDVILLSHQLRVTGTGGVLATAPLVQSK 64
            ||...|  .|.||:       .|:| |.|.||..|||.||:::....|:.||||..|.|||.|:|
Zfish     7 CCFGCCGDNNSGHV-------TLKEMPTVQLDTHHMGTDVVIVKSGRRICGTGGCTANAPLHQNK 64

  Fly    65 SYFEVKIQHGGSWSVGLATRQTDLSRKSGGGDRESWCLCSDNATRHNDREEFRPVVQSACTTQPA 129
            ||||.|||..|.|.:|:||::.:|::...|.|..|..|..|....||:.|:.|            
Zfish    65 SYFEFKIQSTGVWGIGVATQKANLNQIPLGRDPHSLVLRQDGTVYHNNEEKNR------------ 117

  Fly   130 RTSNGILNNSAAKAAGLIAIEDLQQEDLLMTTGVASSDVDIGDSLIASPQRDFPDEGDIVGVAFD 194
                                                           .|....|.|||||||.:|
Zfish   118 -----------------------------------------------LPANSLPQEGDIVGVTYD 135

  Fly   195 HVELNFYFNGKNLEVPFRNVRGAALFPVIYVGNGAILDIILDNFSHGPPPGFERILLEQSL 255
            |||||.|.||||:..|...:|| .::||:||.:.||||....:|.:.||.|:::||.||.:
Zfish   136 HVELNLYLNGKNMNCPASGIRG-TVYPVVYVDDSAILDCQFGDFYYPPPQGYQKILFEQQI 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7785NP_650673.1 SPRYD7 35..256 CDD:293938 76/221 (34%)
spryd7aNP_999941.1 SPRYD7 35..196 CDD:293938 76/221 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170583974
Domainoid 1 1.000 116 1.000 Domainoid score I5927
eggNOG 1 0.900 - - E1_KOG4030
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H10725
Inparanoid 1 1.050 176 1.000 Inparanoid score I4039
OMA 1 1.010 - - QHG48841
OrthoDB 1 1.010 - - D1278394at2759
OrthoFinder 1 1.000 - - FOG0006352
OrthoInspector 1 1.000 - - otm26164
orthoMCL 1 0.900 - - OOG6_106411
Panther 1 1.100 - - O PTHR20951
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3774
SonicParanoid 1 1.000 - - X4623
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.