DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and RIMS3

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:XP_011540781.1 Gene:RIMS3 / 9783 HGNCID:21292 Length:312 Species:Homo sapiens


Alignment Length:252 Identity:104/252 - (41%)
Similarity:143/252 - (56%) Gaps:24/252 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  2549 VHRSE---EVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDG 2610
            :|:.|   :.|..:|.|...|  |:.|.:.......|......|...|..|.             
Human    73 IHQFEGATKKLRSNIRRSTET--GIAVEMRSRVTRQGSRESTDGSTNSNSSD------------- 122

  Fly  2611 AGGERFSPSLR--NDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGL 2673
              |....|:.|  .:...::|:|||||.|:||||.|..|.:||:.:::..:.|.||||||.||||
Human   123 --GTFIFPTTRLGAESQFSDFLDGLGPAQIVGRQTLATPPMGDVHIAIMDRSGQLEVEVIEARGL 185

  Fly  2674 QQKAQSKMLPAPYVKVYLVSGKRCVDKMKTSSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYG 2738
            ..|..||.|||.|:||||:....|:.|.||...::|.||||||.|:|.:...|.:||:.||||||
Human   186 TPKPGSKSLPATYIKVYLLENGACLAKKKTKMTKKTCDPLYQQALLFDEGPQGKVLQVIVWGDYG 250

  Fly  2739 RIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTSLVSCPTNIGLGSRRSSIASLDS 2795
            |::.|.|||:||||||:|:||..|.||||||.|:|:..  :.:|..:||.|.:||:|
Human   251 RMDHKCFMGMAQIMLDELDLSAAVTGWYKLFPTSSVAD--STLGSLTRRLSQSSLES 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994 79/141 (56%)
RIMS3XP_011540781.1 C2 145..290 CDD:301316 79/146 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143513
Domainoid 1 1.000 144 1.000 Domainoid score I4609
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S6337
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 1 1.000 - - FOG0000817
OrthoInspector 1 1.000 - - otm40596
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
87.900

Return to query results.
Submit another query.