DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and rims3

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:NP_001072491.1 Gene:rims3 / 779946 XenbaseID:XB-GENE-5959540 Length:308 Species:Xenopus tropicalis


Alignment Length:292 Identity:112/292 - (38%)
Similarity:162/292 - (55%) Gaps:33/292 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  2520 KKSNSTSQLSA---TGRKRRMGFGKK-----GKNSFTVHRSEEVLPGDITRELR------TGGGL 2570
            :|.||.:..:|   |.:|||...|.|     |.:.::....:...|...|::||      |..|:
 Frog    27 EKGNSANPDAAGVTTTKKRRSSLGAKMVAIVGLSQWSKSTLQLNQPDGTTKKLRSNIRRSTETGI 91

  Fly  2571 GVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGERFSPSLR--NDGALNEFVDGL 2633
            .|.:.......|......|...|..|.               |....|:.|  .:...:.|:|||
 Frog    92 AVEMRNRVTRQGSRESTDGSTNSNSSD---------------GTFIFPTTRLGAESQFSNFLDGL 141

  Fly  2634 GPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCV 2698
            ||.|:||||.|..|.:||:.:.:..:.|.||||||:||||..|..||.:||||:||||:....|:
 Frog   142 GPAQIVGRQTLATPPMGDVHIGMVDRNGQLEVEVIQARGLTPKPGSKSIPAPYIKVYLIENGVCL 206

  Fly  2699 DKMKTSSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVI 2763
            .|.||.::::|.||:|||.|:|.:...|.:||:.|||||||::.|.|||:|||:|::|:||:.|.
 Frog   207 SKKKTRTSKKTWDPVYQQALLFDEGPQGKVLQVIVWGDYGRMDHKCFMGMAQILLEELDLSSCVT 271

  Fly  2764 GWYKLFGTTSLVSCPTNIGLGSRRSSIASLDS 2795
            ||||||.|:||..  ::|...:||.|.:||:|
 Frog   272 GWYKLFPTSSLAD--SSIAPLTRRLSQSSLES 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994 76/141 (54%)
rims3NP_001072491.1 C2 141..284 CDD:387358 77/142 (54%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 148 1.000 Domainoid score I4418
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 1 1.000 - - FOG0000817
OrthoInspector 1 1.000 - - otm47771
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.