DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and Rims3

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:NP_075220.2 Gene:Rims3 / 65025 RGDID:628762 Length:307 Species:Rattus norvegicus


Alignment Length:333 Identity:128/333 - (38%)
Similarity:177/333 - (53%) Gaps:49/333 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly  2476 GSKSAEGAGAEDKVDGSLS---DTANDRKKGGGVDQERSPKGGSGMGKK----------SNSTSQ 2527
            |......|||...|..|.|   :....::.|||.....:.|..|.:|.|          |.||.|
  Rat     4 GEPGPASAGASRNVVRSSSISGEICGSQQAGGGAGTTTAKKRRSSLGAKMVAIVGLTQWSKSTLQ 68

  Fly  2528 LSATGRKRRMGFGKKGKNSFTVHRSEEVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGL 2592
            |     .:..|..||.:::  :.||.|.   .|..|:|:    .|:..|:..:..||        
  Rat    69 L-----PQPEGATKKLRSN--IRRSTET---GIAVEMRS----RVTRQGSRESTDGS-------- 111

  Fly  2593 SRGSSSEVDAIEQFFGDGAGGERFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLC 2657
            :..:|||            |...|...|..:...::|:|||||.|:||||.|..|.:||:.:::.
  Rat   112 TNSNSSE------------GTFIFPTRLGAESQFSDFLDGLGPAQIVGRQTLATPPMGDVHIAIM 164

  Fly  2658 HQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTSSARRTLDPLYQQQLVFKQ 2722
            .:.|.||||||.||||..|..||.|||.|:|.||:....||.|.||..|::|.||||||.|:|.:
  Rat   165 DRSGQLEVEVIEARGLTPKPGSKSLPATYIKAYLLENGACVAKKKTKVAKKTCDPLYQQALLFDE 229

  Fly  2723 SYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTSLVSCPTNIGLGSRR 2787
            ...|.:||:.|||||||::.|.|||:||||||:|:||.:|.||||||.|:|:..  :.:|..:||
  Rat   230 GPQGKVLQVIVWGDYGRMDHKCFMGMAQIMLDELDLSAVVTGWYKLFPTSSVAD--STLGSLTRR 292

  Fly  2788 SSIASLDS 2795
            .|.:||:|
  Rat   293 LSQSSLES 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994 80/141 (57%)
Rims3NP_075220.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 86..120 12/60 (20%)
C2 140..285 CDD:417471 80/146 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166337255
Domainoid 1 1.000 144 1.000 Domainoid score I4482
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 1 1.000 - - FOG0000817
OrthoInspector 1 1.000 - - otm44737
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12157
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.