DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and rims4

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:XP_699547.4 Gene:rims4 / 570923 ZFINID:ZDB-GENE-110103-1 Length:269 Species:Danio rerio


Alignment Length:176 Identity:94/176 - (53%)
Similarity:128/176 - (72%) Gaps:2/176 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly  2620 LRNDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPA 2684
            |.:|...::|:||:||.|.||||.|...|:||:::||..:.|.||||||:||||..|..||..||
Zfish    87 LASDAQFSDFLDGMGPAQFVGRQTLATTSMGDVEISLMERSGQLEVEVIQARGLIMKPGSKGPPA 151

  Fly  2685 PYVKVYLVSGKRCVDKMKTSSARRTLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVA 2749
            .|:||||:....|:.|.||.|.|::|||||.|.|||.:|..|.::|:.|||:|||:::|.|||||
Zfish   152 AYIKVYLLENGICIAKKKTKSVRKSLDPLYNQVLVFSESPQGKVVQVIVWGNYGRMDRKCFMGVA 216

  Fly  2750 QIMLDDLNLSNIVIGWYKLFGTTSLVSCPTNIGLGSRRSSIASLDS 2795
            :|:|::|:||::||||||||.|:|:|. ||...| .|.||..||:|
Zfish   217 RILLEELDLSSMVIGWYKLFPTSSMVD-PTMAPL-IRHSSQLSLES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994 79/141 (56%)
rims4XP_699547.4 C2B_RIM1alpha 100..245 CDD:175994 80/145 (55%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576376
Domainoid 1 1.000 148 1.000 Domainoid score I4404
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 1 1.000 - - FOG0000817
OrthoInspector 1 1.000 - - otm24270
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.