DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and rims3

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:XP_005170109.1 Gene:rims3 / 563414 ZFINID:ZDB-GENE-060503-788 Length:319 Species:Danio rerio


Alignment Length:325 Identity:123/325 - (37%)
Similarity:181/325 - (55%) Gaps:44/325 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  2478 KSAEGAGAEDKVDGSLSDTANDRKKGGGVDQERSPKGGS-----GMGKKSNSTSQLSATGRKRRM 2537
            :|:..:||...::.|.|.|..|.....|..:.||..|..     |:.:.|.||.||:     ::.
Zfish    25 RSSSISGAMYSLEKSPSSTGPDGTSLTGNKKRRSSLGAKMVAIVGLSQWSKSTLQLN-----QQD 84

  Fly  2538 GFGKKGKNSFTVHRSEEVLPGDITRELRTGGGLGVSLGGAGGAAGGSGGAGGGGLSRGSSSEVDA 2602
            |..||.::  |:.||.|.   .|..|:|.    .|:..|:..:..||        :..:||:   
Zfish    85 GGTKKLRS--TIRRSTET---GIAVEMRN----RVTRQGSKDSTDGS--------TNSNSSD--- 129

  Fly  2603 IEQFFGDGAGGERFSPSLR--NDGALNEFVDGLGPGQLVGRQVLGAPSLGDIQLSLCHQKGCLEV 2665
                      |....|:.|  .:...::|:|||||.|:||||.|..||:||:.:.:..:.|.|||
Zfish   130 ----------GTFIFPTTRLGPESQFSDFLDGLGPAQIVGRQTLATPSMGDVYIGVVDRGGQLEV 184

  Fly  2666 EVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTSSARRTLDPLYQQQLVFKQSYTGCILQ 2730
            |:.:||.|..|..||.:||.|:|||::....|:.|.||...::||||.:||.|:|.:|..|.:||
Zfish   185 EITQARSLTPKPGSKNIPATYIKVYVLENGMCLAKKKTKVVKKTLDPTFQQSLMFDESPQGKVLQ 249

  Fly  2731 ITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTSLVSCPTNIGLGSRRSSIASLDS 2795
            :.|||||||::.|.|||:|||:||||:||::|.||||||.|:||..  .:||..:||.|.:||:|
Zfish   250 VIVWGDYGRMDSKCFMGMAQILLDDLDLSSMVGGWYKLFPTSSLAD--PSIGPLTRRLSQSSLES 312

  Fly  2796  2795
            Zfish   313  312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994 75/141 (53%)
rims3XP_005170109.1 C2 152..296 CDD:301316 76/145 (52%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170576379
Domainoid 1 1.000 148 1.000 Domainoid score I4404
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 1 1.000 - - FOG0000817
OrthoInspector 1 1.000 - - otm24270
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.