DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and NANOGNB

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:NP_001138937.1 Gene:NANOGNB / 360030 HGNCID:24958 Length:188 Species:Homo sapiens


Alignment Length:205 Identity:33/205 - (16%)
Similarity:80/205 - (39%) Gaps:59/205 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   228 RAR-MQPMNPQ--QAQQGYGMQQQQQPRSGGAYPDDDPRYYQGELDGLMRQHPHLAHPSQVQPQH 289
            ||| :.|:.|.  :|:.|         ||.|.           |::.::......|.|....|:.
Human     3 RARWLTPVIPALWEAEAG---------RSRGQ-----------EIETILANKKQSAMPWDQDPEQ 47

  Fly   290 TPQSHSQQQQSQHQQQHLMPQQHRPSPQQHSQQQQQQQQHSQQFAARQQQHQQQQHQQQ------ 348
            :..::|:.:|:..|:.....:..|...::..::.:::.|..|:...:::..:|:|:.::      
Human    48 STGNYSEDEQNGKQKWREEGEAGRKREREKEEKNEKELQDEQENKRKRENEKQKQYPEKRLVSKS 112

  Fly   349 ----------------VQQSY---------HAQIHQ---QPQQHPHPHSQQQQHHQQMQHQHGQS 385
                            :|:|.         |.||.|   :.::..:....:::|  :.:|...:|
Human   113 LMHTLWAKFKLNRCPTIQESLSLSFEFDMTHKQISQWFCKTRKKYNKEMSKRKH--KKKHMRWRS 175

  Fly   386 VPQMGGYQKP 395
            :...|..:.|
Human   176 LCCQGWSRTP 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994
NANOGNBNP_001138937.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..106 11/77 (14%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143510
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.