Sequence 1: | NP_001247163.1 | Gene: | Rim / 42150 | FlyBaseID: | FBgn0053547 | Length: | 2798 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001138937.1 | Gene: | NANOGNB / 360030 | HGNCID: | 24958 | Length: | 188 | Species: | Homo sapiens |
Alignment Length: | 205 | Identity: | 33/205 - (16%) |
---|---|---|---|
Similarity: | 80/205 - (39%) | Gaps: | 59/205 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 228 RAR-MQPMNPQ--QAQQGYGMQQQQQPRSGGAYPDDDPRYYQGELDGLMRQHPHLAHPSQVQPQH 289
Fly 290 TPQSHSQQQQSQHQQQHLMPQQHRPSPQQHSQQQQQQQQHSQQFAARQQQHQQQQHQQQ------ 348
Fly 349 ----------------VQQSY---------HAQIHQ---QPQQHPHPHSQQQQHHQQMQHQHGQS 385
Fly 386 VPQMGGYQKP 395 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rim | NP_001247163.1 | PHD_SF | 8..126 | CDD:304600 | |
PDZ_signaling | 817..919 | CDD:238492 | |||
C2A_RIM1alpha | 1148..1272 | CDD:175997 | |||
C2B_RIM1alpha | 2633..2775 | CDD:175994 | |||
NANOGNB | NP_001138937.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 28..106 | 11/77 (14%) | |
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165143510 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |