DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and Rims4

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:NP_898844.1 Gene:Rims4 / 241770 MGIID:2674366 Length:269 Species:Mus musculus


Alignment Length:282 Identity:106/282 - (37%)
Similarity:158/282 - (56%) Gaps:29/282 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  2520 KKSNSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEV--LPGDITRELRTGGGLGVSLGGAGGAAG 2582
            ::|.|...|||:.....:.|  ...|||....:.:.  |.|.|.|...|  ||.|.:...     
Mouse     2 ERSQSRLSLSASFEALAIYF--PCMNSFDDEDAADSRRLKGAIQRSTET--GLAVEMPSR----- 57

  Fly  2583 GSGGAGGGGLSRGSSSEV-DAIEQFFGDG---AGGERFSPSLRNDGALNEFVDGLGPGQLVGRQV 2643
                    .|.:.|...: |::..:..:|   .||    ..|.:|...::|:..:||.|.||||.
Mouse    58 --------TLRQASHESIEDSMNSYGSEGNLNYGG----VCLASDAQFSDFLGSMGPAQFVGRQT 110

  Fly  2644 LGAPSLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTSSARR 2708
            |....:||:::.|..:.|.|||::|:||||..|..||.|||.|:|.||:....|:.|.||..||:
Mouse   111 LATTPMGDVEIGLQERNGQLEVDIIQARGLTAKPGSKTLPAAYIKAYLLENGVCIAKKKTKVARK 175

  Fly  2709 TLDPLYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTS 2773
            :|||||.|.|:|.:|..|.:||:.|||:|||:|:|.|||||:::|::|:|:.:.:||||||.|:|
Mouse   176 SLDPLYNQVLLFPESPQGKVLQVIVWGNYGRMERKQFMGVARVLLEELDLTTLAVGWYKLFPTSS 240

  Fly  2774 LVSCPTNIGLGSRRSSIASLDS 2795
            :|...|  |...|::|..||:|
Mouse   241 MVDPAT--GPLLRQASQLSLES 260

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994 72/141 (51%)
Rims4NP_898844.1 C2 100..245 CDD:417471 73/144 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167833668
Domainoid 1 1.000 144 1.000 Domainoid score I4578
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 1 1.000 - - FOG0000817
OrthoInspector 1 1.000 - - otm42672
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
87.950

Return to query results.
Submit another query.