DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and RIMS4

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:NP_001192246.1 Gene:RIMS4 / 140730 HGNCID:16183 Length:270 Species:Homo sapiens


Alignment Length:278 Identity:103/278 - (37%)
Similarity:150/278 - (53%) Gaps:46/278 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly  2523 NSTSQLSATGRKRRMGFGKKGKNSFTVHRSEEV-----LPGDITRELRTGGGLGVSLGGAGGAAG 2582
            ||.....|.|..||:    ||    .:.||.|.     :|   :|.||...  ..|:..:..:.|
Human    25 NSFDDEDAEGDSRRL----KG----AIQRSTETGLAVEMP---SRTLRQAS--HESIEDSMNSYG 76

  Fly  2583 GSGGAGGGGLSRGSSSEVDAIEQFFGDGAGGERFSPSLRNDGALNEFVDGLGPGQLVGRQVLGAP 2647
            ..|....||:                          .|.:|...::|:..:||.|.||||.|...
Human    77 SEGNLNYGGV--------------------------CLASDAQFSDFLGSMGPAQFVGRQTLATT 115

  Fly  2648 SLGDIQLSLCHQKGCLEVEVIRARGLQQKAQSKMLPAPYVKVYLVSGKRCVDKMKTSSARRTLDP 2712
            .:||:::.|..:.|.|||::|:||||..|..||.|||.|:|.||:....|:.|.||..||::|||
Human   116 PMGDVEIGLQERNGQLEVDIIQARGLTAKPGSKTLPAAYIKAYLLENGICIAKKKTKVARKSLDP 180

  Fly  2713 LYQQQLVFKQSYTGCILQITVWGDYGRIEKKVFMGVAQIMLDDLNLSNIVIGWYKLFGTTSLVSC 2777
            ||.|.|:|.:|..|.:||:.|||:|||:|:|.|||||:::|::|:|:.:.:||||||.|:|:|..
Human   181 LYNQVLLFPESPQGKVLQVIVWGNYGRMERKQFMGVARVLLEELDLTTLAVGWYKLFPTSSMVDP 245

  Fly  2778 PTNIGLGSRRSSIASLDS 2795
            .|  |...|::|..||:|
Human   246 AT--GPLLRQASQLSLES 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492
C2A_RIM1alpha 1148..1272 CDD:175997
C2B_RIM1alpha 2633..2775 CDD:175994 72/141 (51%)
RIMS4NP_001192246.1 C2 101..246 CDD:417471 73/144 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165143511
Domainoid 1 1.000 144 1.000 Domainoid score I4609
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 1 1.000 - - FOG0000817
OrthoInspector 1 1.000 - - otm40596
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR12157
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
76.950

Return to query results.
Submit another query.