DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rim and LOC100537874

DIOPT Version :9

Sequence 1:NP_001247163.1 Gene:Rim / 42150 FlyBaseID:FBgn0053547 Length:2798 Species:Drosophila melanogaster
Sequence 2:XP_003201789.3 Gene:LOC100537874 / 100537874 -ID:- Length:218 Species:Danio rerio


Alignment Length:397 Identity:99/397 - (24%)
Similarity:135/397 - (34%) Gaps:196/397 - (49%)


- Green bases have known domain annotations that are detailed below.


  Fly   829 ILGLKVNGGQPLATGGSVSGAGTGAAIGAGGPCGAIVEKVKRGSVADLEGRIRPGDEILEWNGRG 893
            :|||||.||:...:|..               | |.:.||||||:||..|.:||||::||||||.
Zfish    13 LLGLKVVGGKMTESGRL---------------C-AFITKVKRGSLADTVGHLRPGDQVLEWNGRV 61

  Fly   894 LHNKSADEVYDIIDESRLDAQVELIVSRPIGSGGGSGGSSANVSPISGASGGSANSVPARRSSAN 958
            |...:..|||:||.||:.:.||||:||||||          :|..|..::.|...|     ||::
Zfish    62 LQGATFKEVYNIILESKPEPQVELVVSRPIG----------DVPRIPESTHGQLES-----SSSS 111

  Fly   959 FPHSGLASSMAGSAVVSSGGRYLQRKAPAVEAIEIHRDKPSVLITSPGSPDI--HTSVSGPGSVS 1021
            |                                |..:..||:.:|||.||.:  .||....|.:|
Zfish   112 F--------------------------------ESQKMGPSISVTSPMSPGMLRDTSQYLSGQLS 144

  Fly  1022 GSGLRQRGGVGQTQRLGPSHSTHSHSSSGSGSGSGSSTSSVHAPASAHGPVHASASASGSAPGGL 1086
            ...|.:|                                                          
Zfish   145 SPCLSRR---------------------------------------------------------- 151

  Fly  1087 HGTTTAGHHHHPHPHHYHPHQHPLPHPHQHQGPPAAHLQGHGVGGGIGMGSGSGTTTQPIPIEGR 1151
                                                                   ||..:|   |
Zfish   152 -------------------------------------------------------TTAFVP---R 158

  Fly  1152 LQLKLGYDQNTLQLIVTLVCATGLSLRQSGAGRNPYAKVFLLPDRSHKSKRRTKTVGTTCEPRWG 1216
            :|:||.||:...|||||::.|..|..|:.|..||||.|::.||||.:               ..|
Zfish   159 VQVKLWYDKVGHQLIVTILGAKDLPPREDGRPRNPYVKIYFLPDRRY---------------ILG 208

  Fly  1217 QTFVYSG 1223
            :..:|||
Zfish   209 EVQIYSG 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RimNP_001247163.1 PHD_SF 8..126 CDD:304600
PDZ_signaling 817..919 CDD:238492 41/89 (46%)
C2A_RIM1alpha 1148..1272 CDD:175997 28/76 (37%)
C2B_RIM1alpha 2633..2775 CDD:175994
LOC100537874XP_003201789.3 PDZ_signaling 5..87 CDD:238492 41/89 (46%)
C2 158..>204 CDD:326325 23/45 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D109268at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.