DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tinc and T11F9.12

DIOPT Version :9

Sequence 1:NP_001262686.1 Gene:tinc / 42148 FlyBaseID:FBgn0261649 Length:1513 Species:Drosophila melanogaster
Sequence 2:NP_505916.2 Gene:T11F9.12 / 179579 WormBaseID:WBGene00011713 Length:736 Species:Caenorhabditis elegans


Alignment Length:228 Identity:64/228 - (28%)
Similarity:88/228 - (38%) Gaps:53/228 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   339 YFEVPDLINQDIDEEERQELEEAIRGEEDDGDEGVGVGEEGTVIMPDFDELAPRTAVGTSTTTAK 403
            |.|.|.::|.....||..::||..:.||.:           .:..|......|.|.....|||  
 Worm    65 YTEAPVVVNVGRSSEENNKIEEIEKSEEVE-----------WITAPPRKTPVPITTTREQTTT-- 116

  Fly   404 ASSDADKLNVENWQQLGTLGKADASSSSSSTTSTTTTTTTSTTTTAATTTSTRGTSTTTTTTTIK 468
                             ||....||::.|:|...||||||..:||..|.:|:..|:.:.|||.|:
 Worm   117 -----------------TLRTTSASTTLSTTQPQTTTTTTIPSTTTMTESSSTSTTASPTTTRIR 164

  Fly   469 PMEITTSRQSAH----HHHGKSRKHHKHHNKQRQQQPPRRHHVASHEQAILESFPEEETT----- 524
            ....||...|.|    |.:|:.|.||:||:          ||   |......|.....||     
 Worm   165 TWTYTTRYPSVHDPNRHRYGQDRIHHQHHH----------HH---HHTTTTPSTTTSTTTTTTVA 216

  Fly   525 -TRDSSIHRVRPEVLPELPIPSTPVSASNSKII 556
             |......|||.......|...:|:|:|:|..|
 Worm   217 PTTTEPATRVRVTTARYQPSSYSPISSSSSNSI 249

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tincNP_001262686.1 None
T11F9.12NP_505916.2 HtrL_YibB 461..735 CDD:131247
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR21579
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.