DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and wcaL

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_416548.1 Gene:wcaL / 946565 ECOCYCID:G7095 Length:406 Species:Escherichia coli


Alignment Length:229 Identity:50/229 - (21%)
Similarity:90/229 - (39%) Gaps:44/229 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 FHPIDLTHKHELYLKLAKDY-PQFQAKDAEQSDVLEATAL-----------TQKLA---SGVVQY 249
            ||.||::.:..|     ..| |::|........:|..:.|           .:|:|   .||...
E. coli   150 FHGIDISSREVL-----NHYTPEYQQLFRRGDLMLPISDLWAGRLQKMGCPREKIAVSRMGVDMT 209

  Fly   250 R--------PQRQAVLVSSTSWTPDEDFGILLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEH 306
            |        |.....::|....|..:...:.::|.:..:|  |.....|.     |.|.||.:..
E. coli   210 RFSPRPVKAPATPLEIISVARLTEKKGLHVAIEACRQLKE--QGVAFRYR-----ILGIGPWERR 267

  Fly   307 YVAEIEKLQWQKVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLD-----LPMKVVDMFGSGLP 366
            ....||:.|.:.|..:..:....:...:|..||  |.|..|.:|.|     :|:.:::....|:|
E. coli   268 LRTLIEQYQLEDVVEMPGFKPSHEVKAMLDDAD--VFLLPSVTGADGDMEGIPVALMEAMAVGIP 330

  Fly   367 VCAYDFKCLDELVKHGENGFVF--GDHVQLAEQL 398
            |.:.....:.|||:..::|::.  .|...||::|
E. coli   331 VVSTLHSGIPELVEADKSGWLVPENDARALAQRL 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 50/229 (22%)
PLN02275 7..402 CDD:215155 50/229 (22%)
wcaLNP_416548.1 PRK15427 1..406 CDD:185325 50/229 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.