DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and SPT14

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_015150.2 Gene:SPT14 / 855928 SGDID:S000006096 Length:452 Species:Saccharomyces cerevisiae


Alignment Length:192 Identity:36/192 - (18%)
Similarity:68/192 - (35%) Gaps:32/192 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   154 LVRRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQFHPIDLTHKHELYLKLAKD 218
            |.|.:.:...|.....|.|.           |.||..:       .|..:..:|:.:..::|...
Yeast   220 LTRIIPKVCSSHEDVEFIVA-----------GDGPKFI-------DFQQMIESHRLQKRVQLLGS 266

  Fly   219 YPQFQAKDAE-QSDVLEATALTQKLASGVVQYRPQRQAVLVSSTSWTPDEDFGILLKALQAYEET 282
            .|..:.:|.. |.|:....:||:...:.:|:.......::.:.....|:    :|...:..|.|.
Yeast   267 VPHEKVRDVLCQGDIYLHASLTEAFGTILVEAASCNLLIVTTQVGGIPE----VLPNEMTVYAEQ 327

  Fly   283 AQAEPLVYPS--LLCIITGKGPQKEHYVAEIEKL-QWQKVSVITPWLEIEDYPTV--LASAD 339
            .....||..:  .:.||..|......:...:.|: .|..|:..|    :|.|..:  .:|||
Yeast   328 TSVSDLVQATNKAINIIRSKALDTSSFHDSVSKMYDWMDVAKRT----VEIYTNISSTSSAD 385

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 36/192 (19%)
PLN02275 7..402 CDD:215155 36/192 (19%)
SPT14NP_015150.2 GT4_PIG-A-like 4..408 CDD:340827 36/192 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.