DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and ALG2

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_149078.1 Gene:ALG2 / 85365 HGNCID:23159 Length:416 Species:Homo sapiens


Alignment Length:223 Identity:43/223 - (19%)
Similarity:80/223 - (35%) Gaps:72/223 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 AKDAEQSDVLEATALTQKLASGVVQYRPQRQAVLVSSTSWTPDEDFGILLKALQAYEETAQAEPL 288
            ::|.|:..::.|....:::...|..|:..::.|..|        |.|..:..|:::.:..:...|
Human   256 SQDWERVHLIVAGGYDERVLENVEHYQELKKMVQQS--------DLGQYVTFLRSFSDKQKISLL 312

  Fly   289 VYPSLLCIITGKGPQKEHY-VAEIEKLQWQKVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLD 352
              .|..|::  ..|..||: :..:|.:..|                         |         
Human   313 --HSCTCVL--YTPSNEHFGIVPLEAMYMQ-------------------------C--------- 339

  Fly   353 LPMKVVDMFGSGLPVCAYDFKCLDELVKHGENGFVF-GDHVQLAEQLRIWFENFPKNPSILET-- 414
             |:..|:   ||.|:         |.:.|...||:. .|.|..:|.:    |.|.:.||:..|  
Human   340 -PVIAVN---SGGPL---------ESIDHSVTGFLCEPDPVHFSEAI----EKFIREPSLKATMG 387

  Fly   415 ---RAGFQRKI--QEFQELRWRESWRLI 437
               ||..:.|.  :.|.|..:|...:|:
Human   388 LAGRARVKEKFSPEAFTEQLYRYVTKLL 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 43/223 (19%)
PLN02275 7..402 CDD:215155 31/179 (17%)
ALG2NP_149078.1 GT1_ALG2_like 16..407 CDD:99977 41/213 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.