powered by:
Protein Alignment Alg1 and GSY1
DIOPT Version :9
Sequence 1: | NP_650662.1 |
Gene: | Alg1 / 42146 |
FlyBaseID: | FBgn0038552 |
Length: | 446 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_116670.1 |
Gene: | GSY1 / 850569 |
SGDID: | S000001911 |
Length: | 708 |
Species: | Saccharomyces cerevisiae |
Alignment Length: | 91 |
Identity: | 24/91 - (26%) |
Similarity: | 31/91 - (34%) |
Gaps: | 43/91 - (47%) |
- Green bases have known domain annotations that are detailed below.
Fly 301 GP-QKEHYVAEIEKLQWQKVSV----ITP-------------------WLEIEDYPTVLA----- 336
|| .|..|.:|:|||.|:..|: :.| || ||..|.|:.
Yeast 47 GPLNKATYESEVEKLDWEDESIFPEELLPIQKTLMSMREKGVNFVYGNWL-IEGAPRVILFELDS 110
Fly 337 --------SADLGVCLHWSTSGLDLP 354
.||| ||..|:..|
Yeast 111 VRHFLNEWKADL-----WSLVGIPSP 131
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0438 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.