DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and GSY1

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_116670.1 Gene:GSY1 / 850569 SGDID:S000001911 Length:708 Species:Saccharomyces cerevisiae


Alignment Length:91 Identity:24/91 - (26%)
Similarity:31/91 - (34%) Gaps:43/91 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 GP-QKEHYVAEIEKLQWQKVSV----ITP-------------------WLEIEDYPTVLA----- 336
            || .|..|.:|:|||.|:..|:    :.|                   || ||..|.|:.     
Yeast    47 GPLNKATYESEVEKLDWEDESIFPEELLPIQKTLMSMREKGVNFVYGNWL-IEGAPRVILFELDS 110

  Fly   337 --------SADLGVCLHWSTSGLDLP 354
                    .|||     ||..|:..|
Yeast   111 VRHFLNEWKADL-----WSLVGIPSP 131

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 24/91 (26%)
PLN02275 7..402 CDD:215155 24/91 (26%)
GSY1NP_116670.1 Glycogen_syn 12..683 CDD:399009 24/91 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.