DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and SUS6

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001319374.1 Gene:SUS6 / 843672 AraportID:AT1G73370 Length:942 Species:Arabidopsis thaliana


Alignment Length:219 Identity:50/219 - (22%)
Similarity:76/219 - (34%) Gaps:65/219 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   272 LLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEHYVA---------EIEKLQWQKV--SVI-TP 324
            :|:.|..|..|...|..|.|..:.:.....|....||.         ||....:.|:  ||. ..
plant    67 ILEGLFGYILTCTQEAAVVPPFVALAARPNPGFWEYVKVNSGDLTVDEITATDYLKLKESVFDES 131

  Fly   325 W------LEIE----DY--PTVLASADLGVCLHWSTSGLDLPMKVVDMFGSGL-----PVCAYDF 372
            |      |||:    |:  |.:..|:.:|       .|.|...|.:.....|.     |:..|  
plant   132 WSKDENALEIDFGAIDFTSPRLSLSSSIG-------KGADYISKFISSKLGGKSDKLEPLLNY-- 187

  Fly   373 KCLDELVKHGENGFVFGDHVQLAEQLR-------IWFENFPKNPSILETRAGFQRKIQEFQELRW 430
              |..|..|||| .:..|.:....:|:       |....:.|: :..||.|      |..:|:.:
plant   188 --LLRLNHHGEN-LMINDDLNTVAKLQKSLMLAVIVVSTYSKH-TPYETFA------QRLKEMGF 242

  Fly   431 RESW----------RLIAAPVLEA 444
            .:.|          .:|.:.||||
plant   243 EKGWGDTAERVKETMIILSEVLEA 266

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 46/215 (21%)
PLN02275 7..402 CDD:215155 38/165 (23%)
SUS6NP_001319374.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.