DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and AT4G19460

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_567589.1 Gene:AT4G19460 / 827687 AraportID:AT4G19460 Length:516 Species:Arabidopsis thaliana


Alignment Length:286 Identity:62/286 - (21%)
Similarity:107/286 - (37%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LAIDWHNYTYTVLALGM------------SKGEQSPLIRLV--RRLE--RYFGSKAHTHFCVTRA 175
            ||:.||......|...:            |:|..:.|...|  :.|:  |:|.:.|| |..::.:
plant   221 LAVSWHGIALESLQSSIYQDLIRKPDEPRSQGFNASLYGAVLPKILDEIRFFHNYAH-HIAISDS 284

  Fly   176 MQEDLQQNWGIGPVKVLYDRAPAQFHPIDLTHKHELYLKLAKDYPQFQAKDAEQSDVLEATALTQ 240
            ..|.|:..:.| |.|    |.....:.:|                    ::...||....|....
plant   285 CGEMLRDVYQI-PEK----RVHVILNGVD--------------------ENGFTSDKKLRTLFRS 324

  Fly   241 KLASGVVQYRPQRQAVLVSSTSWTPDEDFG--ILLKALQAYEETAQAEPLVYPSLLCIITGKGPQ 303
            ||.      .|:..:.:|...:....:|.|  :|.:|.....:|       |.::..::.|.||.
plant   325 KLG------LPENSSAIVLGAAGRLVKDKGHPLLFEAFAKIIQT-------YSNVYLVVAGSGPW 376

  Fly   304 KEHYVAEIEKLQWQKVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLDLPMKVVDMFGSGLPVC 368
            ::.|     |...:|||::.. |...:........||.|.......||||.:  ::...||.||.
plant   377 EQRY-----KELGEKVSILGS-LNPNELKGFYNGIDLFVNPTLRPQGLDLTL--MEAMLSGKPVM 433

  Fly   369 AYDFKCLDE-LVKHGENGFVFGDHVQ 393
            |..:..:.. :|.:.|.||:|..:|:
plant   434 ASRYASIKRTIVVNDEFGFMFAPNVE 459

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 62/286 (22%)
PLN02275 7..402 CDD:215155 62/286 (22%)
AT4G19460NP_567589.1 RfaB 108..504 CDD:223515 62/286 (22%)
GT1_YqgM_like 108..504 CDD:99974 62/286 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.