DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and Alg2

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_064382.3 Gene:Alg2 / 56737 MGIID:1914731 Length:415 Species:Mus musculus


Alignment Length:137 Identity:34/137 - (24%)
Similarity:59/137 - (43%) Gaps:33/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 EHYVAEIEKLQWQKVSVITPWLEIEDYPTVLAS-ADLG--------VCLHWSTS----GLDLPMK 356
            ||| .|::|:..:.        ::|.:.|.|.| :|..        :|:.::.|    |: :|::
Mouse   279 EHY-KELKKMVQES--------DLERHVTFLRSFSDRQKISLLHGCLCVLYTPSNEHFGI-VPLE 333

  Fly   357 VVDMFGSGLPVCAYDFKCLDELVKHGENGFVF-GDHVQLAEQLRIWFENFPKNPSILETR--AGF 418
            .:.|   ..||.|.:.....|.:.|...||:. .|.|..:|.:    |.|...||:..|.  ||.
Mouse   334 AMYM---QCPVIAVNNGGPLESIVHKVTGFLCEPDPVHFSEAM----EKFIHKPSLKATMGLAGK 391

  Fly   419 QRKIQEF 425
            .|..::|
Mouse   392 ARVAEKF 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 34/137 (25%)
PLN02275 7..402 CDD:215155 25/110 (23%)
Alg2NP_064382.3 GT4_ALG2-like 17..407 CDD:340834 34/137 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.