DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and PIGA

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_002632.1 Gene:PIGA / 5277 HGNCID:8957 Length:484 Species:Homo sapiens


Alignment Length:412 Identity:87/412 - (21%)
Similarity:132/412 - (32%) Gaps:144/412 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 NPPGIPTLIVCYLYCAVTR-TKLAIDWHNYTYTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTH 169
            |..|:.:.|.....|.:.| .|:.|..|.|       |..||            .||..|....:
Human    45 NMGGVESHIYQLSQCLIERGHKVIIVTHAY-------GNRKG------------IRYLTSGLKVY 90

  Fly   170 FCVTRAMQEDLQQNWGIGPVKVLYDRAPAQ--FHPIDL------------THKHELYLKLAKDYP 220
            :.                |:||:|:::.|.  ||.:.|            .|.|..:..:|.| .
Human    91 YL----------------PLKVMYNQSTATTLFHSLPLLRYIFVRERVTIIHSHSSFSAMAHD-A 138

  Fly   221 QFQAKD---------------AEQSDVLEATALTQKLASG----VVQYRPQRQAVL--------- 257
            .|.||.               |:.|.||....||..|...    .|.|..:...||         
Human   139 LFHAKTMGLQTVFTDHSLFGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIV 203

  Fly   258 ------VSSTSWTPD-----EDFGILLKALQAYE-----------ETAQAEPLVYPSLLCIITGK 300
                  |..|.:|||     :...|::.:...|.           |..|.    ||.|..||.|:
Human   204 SVIPNAVDPTDFTPDPFRRHDSITIVVVSRLVYRKGIDLLSGIIPELCQK----YPDLNFIIGGE 264

  Fly   301 GPQKEHYVAEI-EKLQWQKVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLD-LPMKVVDMFGS 363
            || |...:.|: |:.|......:...||.:|...||....:.:    :||..: ..|.:|:....
Human   265 GP-KRIILEEVRERYQLHDRVRLLGALEHKDVRNVLVQGHIFL----NTSLTEAFCMAIVEAASC 324

  Fly   364 GLPVCAYDFKCLDELVKHGENGFVFGDHVQLAEQLRIWFENFPKNPSILETRAGFQRKIQEFQE- 427
            ||.|.:.....:.|:               |.|.|.|..|     ||:.....|.::.|.:.:. 
Human   325 GLQVVSTRVGGIPEV---------------LPENLIILCE-----PSVKSLCEGLEKAIFQLKSG 369

  Fly   428 -----------LRWRESWRLIA 438
                       ::...:||.:|
Human   370 TLPAPENIHNIVKTFYTWRNVA 391

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 87/412 (21%)
PLN02275 7..402 CDD:215155 79/362 (22%)
PIGANP_002632.1 GT1_PIG-A_like 34..432 CDD:99970 87/412 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.