powered by:
Protein Alignment Alg1 and GlyS
DIOPT Version :9
Sequence 1: | NP_650662.1 |
Gene: | Alg1 / 42146 |
FlyBaseID: | FBgn0038552 |
Length: | 446 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_731967.2 |
Gene: | GlyS / 41823 |
FlyBaseID: | FBgn0266064 |
Length: | 709 |
Species: | Drosophila melanogaster |
Alignment Length: | 132 |
Identity: | 27/132 - (20%) |
Similarity: | 42/132 - (31%) |
Gaps: | 62/132 - (46%) |
- Green bases have known domain annotations that are detailed below.
Fly 93 LISIGRPSFLLVQN--PPGIPTLIVCYLYCAVTRTKLAIDWHNYTYTVLALGMSKGEQSPLIRLV 155
|:.|.|..|.:.:: || ||...:|.||:: |::..:
Fly 456 LVKIKRCMFAMQRDSMPP-------------VTTHNVADDWND----------------PVLSSI 491
Fly 156 RRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQFHPIDLTHKHELYLKLAKDYP 220
||. ..|.|: :||....|||..||..:.|: ..||.
Fly 492 RRC-HLFNSR---------------------------HDRVKMVFHPEFLTSTNPLF---GIDYE 525
Fly 221 QF 222
:|
Fly 526 EF 527
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_COG0438 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.