DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and Alg11

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001262182.1 Gene:Alg11 / 40402 FlyBaseID:FBgn0037108 Length:475 Species:Drosophila melanogaster


Alignment Length:487 Identity:92/487 - (18%)
Similarity:167/487 - (34%) Gaps:163/487 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KKRNA-CVIVLGDIGRSPRMQYHAQSLLEENYHVDMIG---------YLETRPLEELTQHPRCRI 61
            |.:|| .||..|||..||      .|:|::..:|..|.         :|:.|...|...:|.   
  Fly    73 KYQNARMVIYTGDIDASP------NSILQKAKNVFNIAVDSDNVKFVFLKQRHWIEAKNYPH--- 128

  Fly    62 HELTAVPVTNLTPKLRLLFKAFWQTL-SLLMALISIGR----------------PSF-LLVQNPP 108
                              |....|:: |:::.|.::.|                |.| .|.|:..
  Fly   129 ------------------FTLLGQSIGSMVVGLEALCRFPPDIYIDTMGYAFTYPLFRYLAQSKV 175

  Fly   109 GIPTLIVCYLYCAVTRTKL-------AIDWHNYTYTVLALGMSKGEQSPLI--------RLVRRL 158
            |      ||::..|..|.:       .:..:|..|..         ::|.:        ||..|:
  Fly   176 G------CYVHYPVISTDMLKRVQQRQMSHNNKKYVA---------RNPFLTWTKLAYYRLFSRM 225

  Fly   159 ERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQFH----PIDLTHKHELYLKLAKDY 219
            .::.|..|.|....:...:..:.|.|.:          |.:.|    |.:::|...|        
  Fly   226 YKWVGCCAETIMVNSSWTENHILQLWDV----------PFKTHRVYPPCEVSHLKSL-------- 272

  Fly   220 PQFQAKDAEQSDVLEATALTQKLASGVVQYRPQRQAVLVSSTSWTPDEDFGILLKALQAYEETAQ 284
                 :..|:.|                      :.:::|...:.|::|..:.|:|:........
  Fly   273 -----QHTEKGD----------------------EFIILSVGQFRPEKDHPLQLQAIYELRTLLA 310

  Fly   285 AEPLVYPSLLCIITGKGPQKEHYVAEIEKLQWQ-------------KVSVITPWLEIEDYPTVLA 336
            .:..::..:..:|.|....::.|    |:|:..             :.||..|:   ||...:..
  Fly   311 QDEALWNQIKLVIVGSCRNEDDY----ERLKNMQDLTKHLSLENNVQFSVNVPY---EDLLKLYQ 368

  Fly   337 SADLGVCLHWSTSGLDLPMKVVDMFGSGLPVCAYDF--KCLD--ELVKHGENGFVFGDHVQLAEQ 397
            :|.:|:...|:.   ...:.:|:...:||.:.|:..  ..||  |.....:|||:..|.|:.||.
  Fly   369 TAHIGIHTMWNE---HFGIGIVESMAAGLIMVAHKSGGPLLDIVETSAGSQNGFLATDAVEYAEN 430

  Fly   398 -LRIWFENFPKNPSILETRAGFQR-KIQEFQE 427
             |.|...|...|......||..:| ..|||::
  Fly   431 ILNIIVNNSEMNGIRNAARASVERFSEQEFEK 462

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 92/487 (19%)
PLN02275 7..402 CDD:215155 84/459 (18%)
Alg11NP_001262182.1 PLN02949 24..473 CDD:215511 92/487 (19%)
GT1_ALG11_like 44..463 CDD:99978 92/487 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.