DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and gys2

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001018199.1 Gene:gys2 / 373082 ZFINID:ZDB-GENE-030826-31 Length:701 Species:Danio rerio


Alignment Length:157 Identity:32/157 - (20%)
Similarity:54/157 - (34%) Gaps:63/157 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    61 IHELTAVPVTNLTPKLRLLFKAFWQTLSLLMALISIGRPSFLLVQNPPGIPTLIVCYLYCAVTRT 125
            :.|..::||.:|     |||:..|:..:      .:|           ||.|:|       .|:.
Zfish    17 LFEEESLPVEDL-----LLFEVAWEVTN------KVG-----------GIYTVI-------QTKA 52

  Fly   126 KLAID-W------------HNYTYTVLALGMSKGEQSPLIRLVR-RLERYFGSKAHTHFCVTRAM 176
            |:.:| |            ||:...|     .|.|  |..:.:| .::....:....||      
Zfish    53 KITVDEWGENYFMMGPYYEHNFKTQV-----EKCE--PPNQAIRAAMDSLINNGCQVHF------ 104

  Fly   177 QEDLQQNWGI--GPVKVLYDRAPAQFH 201
                 ..|.|  .|..:|:|...|.::
Zfish   105 -----GRWLIEGSPYVILFDIGAAAWN 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 32/157 (20%)
PLN02275 7..402 CDD:215155 32/157 (20%)
gys2NP_001018199.1 GT1_Glycogen_synthase_GSY2_like 27..616 CDD:99967 29/147 (20%)
Glycogen_syn 32..655 CDD:283373 25/137 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.