DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and Alg11

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_001101871.1 Gene:Alg11 / 361174 RGDID:1564725 Length:492 Species:Rattus norvegicus


Alignment Length:191 Identity:44/191 - (23%)
Similarity:83/191 - (43%) Gaps:32/191 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   256 VLVSSTSWTPDEDFGILLKALQAY--EETAQAEPLVYPSLLCIITG--KGPQKEHYVAEIEKLQW 316
            :|||...:.|:::..:.:||....  |:.|::.    .||..::.|  :....|..|.::.:|..
  Rat   302 LLVSIGQFRPEKNHALQIKAFAKLLNEKAAESR----HSLKLVLIGGCRNKDDEFRVNQLRRLSE 362

  Fly   317 Q---------KVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLDLPMKVVDMFGSGLPVCAYDF 372
            .         |:::  .:.|:::|   |:.|.:|:...|:.   ...:.||:...:|..:.|::.
  Rat   363 NLGVQENVEFKINI--SFDELKNY---LSEATIGLHTMWNE---HFGIGVVECMAAGTIILAHNS 419

  Fly   373 --KCLDELVKH-GE-NGFVFGDHVQLAEQLRIWFENFP-KNPSILET-RAGFQR-KIQEFQ 426
              ..||.::.| |: .||:.......||.:.......| |...|.|| ||...| ..|||:
  Rat   420 GGPKLDIVIPHEGQITGFLAESEEGYAETMAHILSLSPEKRLRIRETARASLSRFSDQEFE 480

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 44/191 (23%)
PLN02275 7..402 CDD:215155 33/162 (20%)
Alg11NP_001101871.1 PLN02949 20..492 CDD:215511 44/191 (23%)
GT1_ALG11_like 63..480 CDD:99978 43/189 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.