DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and GYS1

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_002094.2 Gene:GYS1 / 2997 HGNCID:4706 Length:737 Species:Homo sapiens


Alignment Length:152 Identity:32/152 - (21%)
Similarity:51/152 - (33%) Gaps:36/152 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 TPKLRLLFKAFWQTLSLLMALISIGRPSF--LLVQNPPGIPTLIVCYLYCAVTRTKLAIDWHNYT 135
            |.|.:.:.|..|.|.:.:..  ..||..:  |||.:.|.:..::....:..:.|...|....::.
Human   379 TLKGQAVRKQLWDTANTVKE--KFGRKLYESLLVGSLPDMNKMLDKEDFTMMKRAIFATQRQSFP 441

  Fly   136 YTVLALGMSKGEQSPLIRLVRRLERYFGSKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQF 200
             .|....|......|::..:||: ..|.|.|                           ||....|
Human   442 -PVCTHNMLDDSSDPILTTIRRI-GLFNSSA---------------------------DRVKVIF 477

  Fly   201 HPIDLTHKHELYLKLAKDYPQF 222
            ||..|:....|   |..||.:|
Human   478 HPEFLSSTSPL---LPVDYEEF 496

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 32/152 (21%)
PLN02275 7..402 CDD:215155 32/152 (21%)
GYS1NP_002094.2 Glycogen_syn 31..663 CDD:283373 32/152 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 634..737
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.