DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and Gys2

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_663547.2 Gene:Gys2 / 232493 MGIID:2385254 Length:704 Species:Mus musculus


Alignment Length:360 Identity:69/360 - (19%)
Similarity:122/360 - (33%) Gaps:124/360 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 RMQYHAQSLLEENYHVDMIGYLETRPLEELTQHPRCRIHELTAVPVTNL--------TP------ 74
            |..||...:...:.|               ..|....:.|:||:...::        ||      
Mouse   236 RQIYHRYCMERASVH---------------CAHVFTTVSEITAIEAEHMLKRKPDVVTPNGLNVK 285

  Fly    75 ---------KLRLLFKA---------FW--------QTLSLLMA-------------LISIGRPS 100
                     .|..::||         |:        :||.|.:|             |.|:.|.:
Mouse   286 KFSAVHEFQNLHAMYKARIQDFVRGHFYGHLDFDLEKTLFLFIAGRYEFSNKGADIFLESLSRLN 350

  Fly   101 FLLVQNPPGIPTLIVCYLYCAVTRTKLAIDWHNYTYTVLALGMSKGE--QSPLIRLVRRLERYFG 163
            |||..:...: |::|.::..|.|        :|:....|     ||:  :..|...|..|:..||
Mouse   351 FLLRMHKSNV-TVVVFFIMPAKT--------NNFNVETL-----KGQAVRKQLWDTVHCLKEKFG 401

  Fly   164 SKAHTHFCVTRAMQEDLQQNWGIGPVKVLYDRAPAQFHPIDLT-HKHELYLKLAKDYPQFQAKDA 227
            .|.:..  :.|....|:..         :.||.       ||| .|..::....:..|.....:.
Mouse   402 KKLYDG--LLRGEIPDMNS---------ILDRD-------DLTIMKRAIFSTQRQSLPPVTTHNM 448

  Fly   228 --EQSDVLEATALTQKLASGVVQYRPQRQAVL-----VSSTSWTPDEDF-----GILLKALQAYE 280
              :.:|.:.:|  .:::  |:...|..|..|:     :||||.....|:     |..|....:|.
Mouse   449 IDDSTDPILST--IRRI--GLFNNRADRVKVILHPEFLSSTSPLLPMDYEEFVRGCHLGVFPSYY 509

  Fly   281 E-----TAQAEPLVYPSLLCIITGKGPQKEHYVAE 310
            |     .|:...:..||:...::|.|...:.:||:
Mouse   510 EPWGYTPAECTVMGIPSVTTNLSGFGCFVQEHVAD 544

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 69/360 (19%)
PLN02275 7..402 CDD:215155 69/360 (19%)
Gys2NP_663547.2 GT1_Glycogen_synthase_GSY2_like 27..615 CDD:99967 69/360 (19%)
Glycogen_syn 32..657 CDD:283373 69/360 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 620..704
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.