DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and Piga

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_035211.2 Gene:Piga / 18700 MGIID:99461 Length:485 Species:Mus musculus


Alignment Length:313 Identity:69/313 - (22%)
Similarity:103/313 - (32%) Gaps:113/313 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   188 PVKVLYDRAPAQ--FHP------------IDLTHKHELYLKLAKDYPQFQAKD------------ 226
            |::|:|:::.|.  ||.            |.:.|.|..:..:|.| ..|.||.            
Mouse    93 PLRVMYNQSTATTLFHSLPLLRYIFVRERITIIHSHSSFSAMAHD-ALFHAKTMGLQTVFTDHSL 156

  Fly   227 ---AEQSDVLEATALTQKLASG----VVQYRPQRQAVL---------------VSSTSWTPD--- 266
               |:.|.||....||..|...    .|.|..:...||               |..|.:|||   
Mouse   157 FGFADVSSVLTNKLLTVSLCDTNHIICVSYTSKENTVLRAALNPEIVSVIPNAVDPTDFTPDPFR 221

  Fly   267 -------------------EDF--GILLKALQAYEETAQAEPLVYPSLLCIITGKGPQKEHYVAE 310
                               .|.  ||:.:..|.|:|           |..:|.|:|| |...:.|
Mouse   222 RHDSVITVVVVSRLVYRKGTDLLSGIIPELCQKYQE-----------LHFLIGGEGP-KRIILEE 274

  Fly   311 I-EKLQWQKVSVITPWLEIEDYPTVLASADLGVCLHWSTSGLD-LPMKVVDMFGSGLPVCAYDFK 373
            : |:.|......:...||.:|...||....:.:    :||..: ..|.:|:....||.|.:....
Mouse   275 VRERYQLHDRVQLLGALEHKDVRNVLVQGHIFL----NTSLTEAFCMAIVEAASCGLQVVSTKVG 335

  Fly   374 CLDELVKHGENGFVFGDHVQLAEQLRIWFENFPKNPSILETRAGFQRKIQEFQ 426
            .:.|:               |.|.|.|..|     ||:.....|.::.|  ||
Mouse   336 GIPEV---------------LPESLIILCE-----PSVKSLCDGLEKAI--FQ 366

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 69/313 (22%)
PLN02275 7..402 CDD:215155 62/287 (22%)
PigaNP_035211.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26
GT4_PIG-A-like 34..433 CDD:340827 69/313 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.