DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Alg1 and gsy-1

DIOPT Version :9

Sequence 1:NP_650662.1 Gene:Alg1 / 42146 FlyBaseID:FBgn0038552 Length:446 Species:Drosophila melanogaster
Sequence 2:NP_496736.1 Gene:gsy-1 / 174924 WormBaseID:WBGene00001793 Length:672 Species:Caenorhabditis elegans


Alignment Length:152 Identity:31/152 - (20%)
Similarity:50/152 - (32%) Gaps:53/152 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   214 KLAKDYPQFQAKDAEQSDVLEATALTQKLASGVVQYRPQRQAVLVSSTSWTPDEDFGILLKALQA 278
            |:||   ....:|.::.:|||..|          ....:.:...|...:|......|.:...|::
 Worm    15 KIAK---TIAGEDLDEEEVLEMDA----------GQSAREEGRFVFECAWEVANKVGGIYTVLRS 66

  Fly   279 YEETAQAEPLVYPSLLCIITGKGPQKEHYVAEIEKLQWQ-KVSVITP------------------ 324
            ..:.:..|   .....|:.   ||.|:.        :|: :|..|.|                  
 Worm    67 KAQISTEE---LGDQYCMF---GPMKDG--------KWRLEVDPIEPENRTIRAAMKRFQADGFR 117

  Fly   325 -----WLEIEDYPTVLASADLG 341
                 || ||.||.|:. .|||
 Worm   118 CMYGRWL-IEGYPKVIL-FDLG 137

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Alg1NP_650662.1 GT1_ALG1_like 6..442 CDD:99986 31/152 (20%)
PLN02275 7..402 CDD:215155 31/152 (20%)
gsy-1NP_496736.1 GT1_Glycogen_synthase_GSY2_like 43..636 CDD:99967 23/111 (21%)
Glycogen_syn 48..672 CDD:283373 22/106 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0438
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.