| Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001362745.1 | Gene: | ZNF518B / 85460 | HGNCID: | 29365 | Length: | 1074 | Species: | Homo sapiens |
| Alignment Length: | 201 | Identity: | 54/201 - (26%) |
|---|---|---|---|
| Similarity: | 87/201 - (43%) | Gaps: | 23/201 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 202 RSIK--RYVCDQCGWSFNDHSNMKDHKLRHFEEKFSCDECGRKFYTMPLLRLHIRVHHKGEKPYV 264
Fly 265 CKFCGMGFANSPSRCRHERQMHANE-LVHPCKICGKRFNSEKGRLK-HEEGHKSDQPDVHICLTC 327
Fly 328 NKEFKE--AQF-LHRHYSTKYHRKRVNLLVNGPKEEFQSEVDPAEFPGYM---EEGQAEM-EDNQ 385
Fly 386 AELDVM 391 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Odj | NP_650661.1 | zf-AD | 5..77 | CDD:214871 | |
| COG5048 | <202..343 | CDD:227381 | 42/147 (29%) | ||
| C2H2 Zn finger | 209..229 | CDD:275368 | 8/19 (42%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 249..274 | CDD:290200 | 9/24 (38%) | ||
| C2H2 Zn finger | 265..283 | CDD:275368 | 4/17 (24%) | ||
| C2H2 Zn finger | 298..314 | CDD:275368 | 4/16 (25%) | ||
| zf-C2H2_jaz | 322..347 | CDD:288983 | 5/27 (19%) | ||
| C2H2 Zn finger | 324..343 | CDD:275368 | 4/21 (19%) | ||
| ZNF518B | NP_001362745.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 12..36 | ||
| C2H2 Zn finger | 137..157 | CDD:275368 | 8/19 (42%) | ||
| zf-H2C2_5 | 164..186 | CDD:372805 | 7/22 (32%) | ||
| C2H2 Zn finger | 164..184 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 192..213 | CDD:275368 | 4/20 (20%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 568..590 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 603..632 | ||||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 678..704 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S8154 |
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.950 | |||||