DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and TT1

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_174737.2 Gene:TT1 / 840386 AraportID:AT1G34790 Length:303 Species:Arabidopsis thaliana


Alignment Length:163 Identity:34/163 - (20%)
Similarity:51/163 - (31%) Gaps:64/163 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   207 YVCDQCGWSFNDHSNMKDHKLRHFEEK--------------------FSCDECGRKFYTMP---- 247
            :.|..|..:||.::|::.|...|..:.                    :.|.|..|.....|    
plant   145 FSCHVCFKTFNRYNNLQMHMWGHGSQYRKGPESLKGTQPRAMLGIPCYCCVEGCRNHIDHPRSKP 209

  Fly   248 -----LLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKRFNSEKGR 307
                 .|:.|.:..| |.||:.|:.||...|.......||            |.||||:      
plant   210 LKDFRTLQTHYKRKH-GHKPFSCRLCGKLLAVKGDWRTHE------------KNCGKRW------ 255

  Fly   308 LKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRH 340
                           :|: |..:||..:.|..|
plant   256 ---------------VCV-CGSDFKHKRSLKDH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871
COG5048 <202..343 CDD:227381 34/163 (21%)
C2H2 Zn finger 209..229 CDD:275368 6/19 (32%)
C2H2 Zn finger 236..256 CDD:275368 6/28 (21%)
zf-H2C2_2 249..274 CDD:290200 9/24 (38%)
C2H2 Zn finger 265..283 CDD:275368 5/17 (29%)
C2H2 Zn finger 298..314 CDD:275368 3/15 (20%)
zf-C2H2_jaz 322..347 CDD:288983 6/19 (32%)
C2H2 Zn finger 324..343 CDD:275368 6/17 (35%)
TT1NP_174737.2 C2H2 Zn finger 231..247 CDD:275368 4/15 (27%)
C2H2 Zn finger 257..274 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 62 1.000 Inparanoid score I2531
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.050

Return to query results.
Submit another query.