DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and ZNF8

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_066575.2 Gene:ZNF8 / 7554 HGNCID:13154 Length:575 Species:Homo sapiens


Alignment Length:370 Identity:90/370 - (24%)
Similarity:133/370 - (35%) Gaps:103/370 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LDLTQAVAFRQRCLETHANL-------------------------------------HQRISSKA 83
            ||.||.:.:|...|||..:|                                     ..|..|:|
Human    42 LDPTQRILYRDVMLETFGHLLSIGPELPKPEVISQLEQGTELWVAERGTTQGCHPAWEPRSESQA 106

  Fly    84 GVASKGSPEVSPVLSDPLLKRE--VLDDTVDTEDDKELLDDDKDLMDDDKDFLEDEKPILRYPPA 146
            ....:|.||..|   ..:..||  ..|....|...|:.....:.|...:::.|:..:..|:..| 
Human   107 SRKEEGLPEEEP---SHVTGREGFPTDAPYPTTLGKDRECQSQSLALKEQNNLKQLEFGLKEAP- 167

  Fly   147 KKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPPPR-----------------EH------- 187
                ::||.:        :..|||...| .:.||.|.|.                 ||       
Human   168 ----VQDQGY--------KTLRLRENCV-LSSSPNPFPEISRGEYLYTYDSQITDSEHNSSLVSQ 219

  Fly   188 -VRKPRKRR--------------PKPKVDRS---IKRYVCDQCGWSFNDHSNMKDHKLRHFEEK- 233
             ...|.|:.              |..::.:|   .|.|.|..||.|||.::::..||..|..|: 
Human   220 QTGSPGKQPGENSDCHRDSSQAIPITELTKSQVQDKPYKCTDCGKSFNHNAHLTVHKRIHTGERP 284

  Fly   234 FSCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICG 298
            :.|.|||:.|.....|..|.|: |.|:|||.|..||..|.:|.....| |::|..|..:.|:.||
Human   285 YMCKECGKAFSQNSSLVQHERI-HTGDKPYKCAECGKSFCHSTHLTVH-RRIHTGEKPYECQDCG 347

  Fly   299 KRFNSEKGRLKHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYST 343
            :.||......:|:..|..::|  :.|..|.|.|.....|..|..|
Human   348 RAFNQNSSLGRHKRTHTGEKP--YTCSVCGKSFSRTTCLFLHLRT 390

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871 9/57 (16%)
COG5048 <202..343 CDD:227381 49/144 (34%)
C2H2 Zn finger 209..229 CDD:275368 8/19 (42%)
C2H2 Zn finger 236..256 CDD:275368 8/19 (42%)
zf-H2C2_2 249..274 CDD:290200 12/24 (50%)
C2H2 Zn finger 265..283 CDD:275368 6/17 (35%)
C2H2 Zn finger 298..314 CDD:275368 4/15 (27%)
zf-C2H2_jaz 322..347 CDD:288983 7/22 (32%)
C2H2 Zn finger 324..343 CDD:275368 6/18 (33%)
ZNF8NP_066575.2 KRAB 25..85 CDD:214630 9/42 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 92..130 9/40 (23%)
COG5048 <167..404 CDD:227381 66/242 (27%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..237 4/26 (15%)
C2H2 Zn finger 259..279 CDD:275368 8/19 (42%)
C2H2 Zn finger 287..307 CDD:275368 8/20 (40%)
C2H2 Zn finger 315..335 CDD:275368 7/20 (35%)
C2H2 Zn finger 343..363 CDD:275368 6/19 (32%)
C2H2 Zn finger 371..391 CDD:275368 7/20 (35%)
zf-C2H2 397..419 CDD:306579
C2H2 Zn finger 399..419 CDD:275368
zf-C2H2 467..489 CDD:306579
C2H2 Zn finger 469..489 CDD:275368
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 488..533
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.