DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Odj and E4f1

DIOPT Version :9

Sequence 1:NP_650661.1 Gene:Odj / 42145 FlyBaseID:FBgn0038551 Length:430 Species:Drosophila melanogaster
Sequence 2:NP_001171975.1 Gene:E4f1 / 681359 RGDID:1596731 Length:783 Species:Rattus norvegicus


Alignment Length:475 Identity:110/475 - (23%)
Similarity:184/475 - (38%) Gaps:93/475 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 ECRICGERI-----FTPHPKNIFEKRNHRIRMAIEQITGLEIVLENMLPQHICACCLLDLTQAVA 63
            :|..||:..     .|.|.|:: .....:||.:|.:.|.   |.:..:|....|..:..:|.:||
  Rat   250 KCAKCGKSFRESGALTRHLKSL-TPCTEKIRFSISKDTA---VGKEEVPAGSSASTVGTVTSSVA 310

  Fly    64 FRQRCLETHANLHQRISSKAGVASKGSPEVSPVLSDPLLKREVLDDTVDTED--------DKELL 120
            ...  :||...:|....:|..|..:...::..:   ||..:.:..::.|.|:        .:.||
  Rat   311 GEP--METSPVIHLVTDAKGTVIHEVHVQMQEL---PLGMKALTPESADCEELPCSRENSRENLL 370

  Fly   121 DDDKDLMDDDKDFLEDEKPILRYPPAKKIRIEDQNFPNRQS--PRVRVKRLRVPVVEKADSPPPP 183
            ...........|.:..|:..|:  ||.......|:..:..|  |.:.|:::...|..:|.:.|..
  Rat   371 HQAMQNSGIVLDRVAGEESTLQ--PAPPSGSSPQSLGDGPSELPLLEVEQIETQVASEAATVPRT 433

  Fly   184 ----------PREHVRKPRKR---RPKPKVDRSIKRYVCDQCGWSFNDHSNMKDHKLRH-FEEKF 234
                      |.....:..||   .|:|        :.|.|||.:|.....:|.|:..| .|.:|
  Rat   434 HPCSQCSETFPSAATLEAHKRGHIGPRP--------FTCTQCGKAFPKAYLLKKHQEVHVHERRF 490

  Fly   235 SCDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGK 299
            .|.:||:.:.|:..:|.|.|| |..|:|:.|..||..:....::..|.| .|..|..|.|:.|.:
  Rat   491 RCGDCGKLYKTIAHVRGHRRV-HSDERPFPCPQCGKRYKTKNAQQVHFR-THLEEKPHVCQFCSR 553

  Fly   300 RFNSEKGRL-KHEEGHKSDQPDVHICLTCNKEFKEAQFLHRHYSTK---------------YHRK 348
            .|. |||.| :|...|..::|  ..|..|.:.|.|...|:||..||               ....
  Rat   554 GFR-EKGSLVRHVRHHTGEKP--FKCYKCGRGFAEHGTLNRHLRTKGGCLLEVEELLVSEESPSA 615

  Fly   349 RVNLLVNGPKE---EFQSEVDPAEFPGYMEEGQAE----------MEDNQAELD----VMLDNID 396
            ...:|...|..   ||.|.|  |:...|:.|..|:          :|..|.|:|    .::..|.
  Rat   616 AATVLAEDPHTVLVEFSSVV--ADTQEYIIEATADDTETSEATEIIEGTQTEVDSHIMKVVQQIV 678

  Fly   397 EEQYEDHEVL-----QDEDA 411
            .:....|:::     .|::|
  Rat   679 HQAGAGHQIIVQNVTMDQEA 698

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
OdjNP_650661.1 zf-AD 5..77 CDD:214871 18/76 (24%)
COG5048 <202..343 CDD:227381 46/142 (32%)
C2H2 Zn finger 209..229 CDD:275368 7/19 (37%)
C2H2 Zn finger 236..256 CDD:275368 7/19 (37%)
zf-H2C2_2 249..274 CDD:290200 10/24 (42%)
C2H2 Zn finger 265..283 CDD:275368 4/17 (24%)
C2H2 Zn finger 298..314 CDD:275368 6/16 (38%)
zf-C2H2_jaz 322..347 CDD:288983 9/39 (23%)
C2H2 Zn finger 324..343 CDD:275368 7/18 (39%)
E4f1NP_001171975.1 COG5048 193..594 CDD:227381 90/367 (25%)
C2H2 Zn finger 195..215 CDD:275368
zf-C2H2 221..243 CDD:278523
C2H2 Zn finger 223..243 CDD:275368
zf-H2C2_2 235..258 CDD:290200 3/7 (43%)
C2H2 Zn finger 251..269 CDD:275368 5/17 (29%)
C2H2 Zn finger 436..456 CDD:275368 3/19 (16%)
zf-H2C2_2 449..471 CDD:290200 8/29 (28%)
zf-C2H2 462..484 CDD:278523 7/21 (33%)
C2H2 Zn finger 464..484 CDD:275368 7/19 (37%)
C2H2 Zn finger 492..512 CDD:275368 8/20 (40%)
zf-H2C2_2 504..529 CDD:290200 10/25 (40%)
C2H2 Zn finger 520..540 CDD:275368 5/20 (25%)
C2H2 Zn finger 548..568 CDD:275368 8/20 (40%)
zf-H2C2_2 560..584 CDD:290200 6/25 (24%)
C2H2 Zn finger 576..595 CDD:275368 7/18 (39%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24390
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.