| Sequence 1: | NP_650661.1 | Gene: | Odj / 42145 | FlyBaseID: | FBgn0038551 | Length: | 430 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_079600.1 | Gene: | Zfp524 / 66056 | MGIID: | 1916740 | Length: | 321 | Species: | Mus musculus |
| Alignment Length: | 241 | Identity: | 63/241 - (26%) |
|---|---|---|---|
| Similarity: | 84/241 - (34%) | Gaps: | 70/241 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 135 EDEKPILRYPPAKKIRIEDQNFPNRQSPRVRVKRLRVPVVEKADSPPPP--------------PR 185
Fly 186 EHVRKPRKRRPKPKV---------------DRSIKRYVCDQCGWSFNDHSNMKDHKLRHFEEKFS 235
Fly 236 CDECGRKFYTMPLLRLHIRVHHKGEKPYVCKFCGMGFANSPSRCRHERQMHANELVHPCKICGKR 300
Fly 301 FNSEKGRLKHEEG-HKSDQPDVHICLTCNKEFKEAQFLHRHYSTKY 345 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Odj | NP_650661.1 | zf-AD | 5..77 | CDD:214871 | |
| COG5048 | <202..343 | CDD:227381 | 43/141 (30%) | ||
| C2H2 Zn finger | 209..229 | CDD:275368 | 1/19 (5%) | ||
| C2H2 Zn finger | 236..256 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 249..274 | CDD:290200 | 11/24 (46%) | ||
| C2H2 Zn finger | 265..283 | CDD:275368 | 8/17 (47%) | ||
| C2H2 Zn finger | 298..314 | CDD:275368 | 6/16 (38%) | ||
| zf-C2H2_jaz | 322..347 | CDD:288983 | 10/24 (42%) | ||
| C2H2 Zn finger | 324..343 | CDD:275368 | 9/18 (50%) | ||
| Zfp524 | NP_079600.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..80 | 18/91 (20%) | |
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 86..105 | 2/20 (10%) | |||
| COG5048 | <102..218 | CDD:227381 | 42/125 (34%) | ||
| C2H2 Zn finger | 111..131 | CDD:275368 | 6/20 (30%) | ||
| C2H2 Zn finger | 139..159 | CDD:275368 | 8/20 (40%) | ||
| C2H2 Zn finger | 167..187 | CDD:275368 | 8/20 (40%) | ||
| C2H2 Zn finger | 195..216 | CDD:275368 | 9/20 (45%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 248..321 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24390 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||